KEGG   Cryptococcus neoformans JEC21: CNA06290Help
Entry
CNA06290          CDS       T00243                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNA06290
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNA06290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNA06290
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CNA06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(1707222..1707321,1707408..1707744,1707797..1708967,1709024..1709259,1709315..1709408,1709454..1709610,1709656..1709663,1709710..1709754))
Genome map
AA seq 715 aa AA seqDB search
MAEQLKQVYADKKAQDQAAFVTFLTAGFPTRDATVPLMLALEAGGADIIELGVPFSDPVA
DGPVIQKANNVAIENNVHYSDCIEYVRQARAQGLKAPVLFMGYYNPIIAYGEERAVKDAR
EAGANGYIVVDLPPTEAVDFRNTCTKAGMSYIPLVAPSTSIDRVKFLTSIADSFIYVVSK
MGVTGSSSSENISASLPELVKRIRTFTTIPLAVGFGIDNRTHFDYVTSSGADAVVVGSKI
IKLIFEHADDGLAPKVVEDYCREITLKGQNPPPLGRKNAAAPPPANGGDVSPPLPIPSGS
PLGESQVKVTAAGKLPSRFGLFGGAYVAESLVDCLNELEAAYAEAKEDPAFWKEFEDMFG
YINRPSELYLAERLTEEMGGARIWLKREDLNHTGSHKINNAVGQILLAKRLGKRRIIAET
GAGQHGVATATVCAKFGMECDIFMGAEDVRRQELNVFRIKMLGGRVIPVTAGSQTLKDAV
NEAMRDWVTRLDSTHYLIGSAIGPHPFPTIVRDFQRVIGREIKSQMHEKMGKLPDAVVAC
VGGGSNAIGTFYDFIEDPSVRLVGVEAGGHGIDTEAHSATLTKGVMGVVHGAASYIIQSK
EGQLTPTHSISAGLDYNSVGPEHSHLKYSGRAEYVVADDLQCLKAFKMCTELEGIIPALE
SSHGLWGGMQLAKSLPKDKDIVICLSGNGAKDVAEVLLTLKNKEWADKLDWHVAQ
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcagctcaagcaagtatacgcagacaaaaaggcccaggaccaggccgccttt
gtcacctttttgacagctggtttccctacccgcgatgccacagtgcccctcatgctcgcc
ctagaggcaggcggtgctgacattatcgaactcggtgtcccattcagtgacccagtcgcc
gacggtccggtcatccaaaaggccaacaacgttgccattgaaaacaatgtccactactct
gactgtatcgagtacgtccgacaggctcgtgcccaaggtctcaaggctcccgtcttgttc
atgggctactacaaccccatcatcgcttatggcgaggaaagagctgtcaaggacgctcga
gaggccggtgccaacggctacatcgtcgtcgacttgccccccaccgaagccgtcgacttt
agaaatacttgtaccaaggcgggcatgtcgtacattcccctcgtcgccccttctaccagc
atcgatcgagtcaagttcttgacttctatcgccgattctttcatctatgtcgtctccaag
atgggtgtcaccggttcctcttcttccgaaaacatctcagcctccctccccgaacttgtc
aagcgtatccgaacgttcaccacgatccccctcgctgtcggttttggtatcgacaaccgt
acccactttgactatgtcacatcttccggtgctgatgctgttgtcgttggatccaaaatc
atcaagctcatctttgagcacgccgacgacggtcttgcacccaaggtcgtcgaagactat
tgccgagaaatcacactcaagggccagaaccctccccctcttggccgaaagaatgctgct
gccccgcctcctgccaatggaggtgacgtctctccccccctccccattccctctggctca
cctctcggcgagtcccaagtcaaggtcaccgccgccggtaaactcccttctcgattcggt
cttttcggtggcgcctatgtcgccgaatcccttgtcgactgtttaaacgagctcgaagct
gcgtatgccgaggccaaggaggatcctgcgttctggaaagagtttgaggatatgtttggg
tacatcaaccgacctagtgaactttaccttgccgagaggttgaccgaggagatgggcggt
gcgaggatctggctcaagagggaagatctcaaccatactggttctcacaagattaacaat
gccgttggccaaattctcctcgccaagcgattgggtaagcgaagaattatcgccgagacg
ggtgccggtcagcacggtgtcgctaccgccaccgtctgcgccaagtttggcatggagtgt
gacattttcatgggtgctgaggatgtgaggaggcaagagctgaacgtcttcaggatcaag
atgcttggtggtcgagttatccccgttaccgccggttcccagaccttgaaggacgctgtc
aacgaggctatgagagattgggtcactcgattggactctactcattatcttatcggctcc
gctatcggtccccacccgttccccaccatcgtccgtgacttccagagggttatcggtcga
gagatcaagtctcagatgcacgaaaagatgggcaagttgcccgatgctgtcgttgcctgt
gtcggtggtggctctaatgcgatcggtactttttacgactttatcgaggatccgagtgta
agactggtcggtgtcgaagctggtggtcatggtattgacaccgaggcacactctgctacg
ctgaccaagggtgtcatgggtgtcgtccacggcgccgcttcttacattatccaatcaaag
gaaggccagctcacccccacgcactccatctctgccggtctcgactacaactctgtcggt
cccgagcactctcacctcaagtatagcggtcgagcggaatatgtcgtggcggacgatttg
cagtgtctcaaggcgttcaagatgtgtaccgaattggaaggtattattcccgctttggag
agcagtcatggtttgtggggcggtatgcagttggccaagagtttgcccaaggataaggat
atcgtcatctgtttgagtggaaacggtgccaaagacgttgcagaggtgttgttgacgttg
aagaacaaggagtgggcggacaagcttgattggcacgttgcgcagtag

DBGET integrated database retrieval system