KEGG   Cryptococcus neoformans JEC21: CNA06390Help
Entry
CNA06390          CDS       T00243                                 

Definition
histone deacetylase
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CNA06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(1733515..1733901,1733943..1734150,1734232..1734293,1734411..1734616,1734669..1734709,1734757..1734929,1734993..1735541))
Genome map
AA seq 541 aa AA seqDB search
MSPADGPLGLFVQPACLQHRYIRHPNAAHVFERPERLRAVLLGVAAAVARLEQAAPAPQP
PHDLASLLSSLSLLSRAQPTAQLHLVPAPPPPPRPGSVLLHHPAVQLAHSPVPEAPFPYI
GPGSTGPSGAGFPSSGYLRDLVKWANEAAERIKQTGCEIPDGLGLNPGDLYLGPGSIVAI
EGAIQTVCQAVDHVVQKTKQVPVKEEPSTPPVEGPADALFTKAFCAIRPPGHHCGEDAPS
GFCYVNNVVIGALHGYLQHDIDRAIIIDFDLHHGNGTQALIMPLNAASYADDLQVKAGKP
PITGQGGRRRRGWKAFYGSVHDIDGDLDLIRDASISLAAHGQYIENIHLKPYSSEADFYD
RIYPLYLALLDKAKVFMEQTEADPERTIVFISAGFDACEWEHQGMQRHDRRVPLTANVCK
VSFYSRYTRDIAAFADKYTEGKVVSVLEGGYSDRALTSAAMGHIVGMRGSLPEGCDEWWA
EKELISVGPPDCLHLSEYFGLTSDLAGKGNQKEERRQACPSSSRVCFTTPSLPNALSPRP
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccgccgacggccccctcggcctcttcgtgcagcccgcctgtctccagcacagg
tacatccgccatccaaacgccgcccacgtattcgagcgcccagaacgcctccgcgccgtc
ctcctcggcgtcgctgctgccgtcgccaggctcgagcaggccgcacccgctccccagccg
ccacacgacctcgccagcctgctctcctccctctccctcctgtcccgcgcccagcccacc
gcccagctccacctcgtgcccgccccgcccccgccgcccaggccgggcagtgtcctgctg
caccacccggcagtccagctcgcccactcgcccgtccccgaggcgccctttccgtatatc
gggccagggtccacgggcccgtccggggcgggcttcccctcgtccggctatcttagggat
ctggtcaaatgggccaacgaggcggcggagagaatcaagcagacggggtgcgaaatacca
gacgggctgggactgaaccctggagatctttaccttggcccgggaagtatcgttgccatc
gagggcgctatccaaacggtctgccaagcggtagatcatgttgtgcaaaagacaaaacag
gtacctgtgaaggaggagccgtctacgccccctgttgagggtcctgcagacgcgctgttc
acgaaagcgttctgtgctataagaccacccggtcaccactgcggcgaagatgcaccctcg
gggttttgctatgtcaacaacgtggtcattggcgctctgcatggctacctccagcacgac
attgatcgcgcgattatcattgatttcgatctccaccacggtaacggcactcaagcgctc
atcatgcccctcaacgcagcttcttatgcagatgatctacaggtcaaggctggaaagcca
ccgataacaggacaaggagggagaaggagaagaggctggaaggcattctatggatcggtg
catgacattgatggtgatcttgatctcattcgagacgcctcaatctctctagctgctcat
gggcagtacatcgaaaacatccatcttaaaccatacagctcggaagccgatttctacgac
cgaatctaccctctataccttgcactcttggacaaggccaaagtatttatggaacagacc
gaggcggacccagagagaaccattgttttcataagcgcaggattcgatgcttgtgaatgg
gaacatcaaggaatgcagcggcatgatcgccgagtacctctgacggcaaacgtttgcaag
gtttcgttctattcgaggtatacgcgtgatattgcggcttttgcggacaaatacacagag
ggcaaggttgtctccgtgttggaaggcggttacagcgatcgagcattgacgagtgcagcc
atgggtcacattgtgggaatgagagggtctttgcctgaaggatgtgatgaatggtgggct
gaaaaagagttgatcagtgtaggcccccccgactgtttacatctttcagaatattttggg
ctcacgagtgatttagctggaaaaggcaaccaaaaagaagagaggaggcaagcttgcccc
tcttccagcagagtttgcttcacaaccccatctctcccgaacgcactctctcctcgccca
ttttga

DBGET integrated database retrieval system