KEGG   Cryptococcus neoformans JEC21: CNA06620Help
Entry
CNA06620          CDS       T00243                                 

Definition
protein serine/threonine kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CNA06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(1805964..1807028,1807077..1807260,1807311..1807491,1807544..1807710,1807764..1807885,1807940..1808208,1808270..1808371,1808432..1808545,1808599..1808632)
Genome map
AA seq 745 aa AA seqDB search
MSTSSHLAHATHLPRPADSLPRSPYPHDAQHSPLPPPSFLHAFPLPPRASISSVAAPPAS
APLHSAPPYSSAQTLRASLPLPHPYYPLPLPHTPSGHRVLRSPNPPCLWPLPHPLPAIDS
LRRPSRHPPHPASHSGSPSLDHPRAYYDPTVSVPLAYRESYPSHPSTHPSSPYLPPPTPS
AYGYRAPSPFRIPPPLTFRYSRSPPPLDTMPPRKKAEPSTADTAAASNASATTGAPASAS
TRARRGANGKGWTTEHTYEPNGQRKEVIVIDDSASPMVQPVRKRTRAQVAAEQAAQQQQL
HQAYASTNAGYSDTVSISNGHGSVASTAGTAAGGTTKKRKLEEDQGKKAKAKVASTATSA
SIQTTGTWQSTQQAAPAKATQYQKAPAQPAQQQGPPPWDDPEGHYIVKPDDVIGGRYKIV
RLLGQGTFGKVVEARHIETRRKVAIKVIRAVQKYREASKIEIRVLETLRKHDPRNDNKCI
HLDEYFDFRNHPCLVSELYGMSVFDFLKQNGFQPFPDKHIQDFAKSLLRSVSYLHSLKLV
HTDLKPENILLCSNEARLAGPRVRNARSKSILKNTEIRLIDFGSATFESEYHSSVVSTRH
YRAPEIILGLSWSYPCDMFSIGCILVEFYTGNALFQTHDNLEHLAMMEVVMGKFSQRMIE
KGKSKKPEYFKGNKIDFPNSTVSKASRKYVKSMQSLKQVIDPANRHQQLFLDLCTRLLEH
DPDVRIKVQDALRHPYLTEPIPEPA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagcagccacctcgcccacgccacccacctcccccgccccgcagactccctc
ccccgcagcccatacccgcacgacgcccagcactcgccgctccctcccccgtccttcctc
cacgcctttccgctgccgccccgggcgtccatctcctccgtcgctgcgcccccggcgagc
gccccgctgcactctgcgccgccctactcgtccgcacagaccctccgtgcctcgctgccg
ctcccccacccgtactacccgctccccctgccacacaccccgtccggccaccgcgtgctc
cgctcccccaacccgccgtgtctctggccgctgccccacccgctgcccgccatcgactcc
ctccggcgcccgtcccgccatcccccgcaccccgcctcccactccggctcgcccagcttg
gaccacccgcgagcctactacgatcccaccgtctccgtcccgctcgcctaccgcgagtcg
tatccgtcccacccgtccacccacccaagttccccctatcttccccctcccaccccgtcc
gcgtacggctaccgcgccccgtccccgttccggatcccgcctccgttgacgttcaggtac
tctcgctcaccgccgcctcttgacaccatgccgccacgcaaaaaggccgagccgtcgacc
gcagacacagcggctgcatccaatgcatcagcgactaccggcgcaccggcctctgccagc
acgagagcaagaagaggtgccaacggcaagggatggacgaccgagcacacgtacgagccc
aacggccagcgcaaggaggtcatcgtcattgacgattctgccagcccaatggtgcagcct
gtgagaaagaggacacgggcgcaggtcgcggctgagcaagcagcccagcaacagcagtta
catcaggcctatgcgagcacgaacgcgggctactcagatacggtgagcatatcaaatggg
cacggcagcgtggccagcaccgccggtacagcagcgggaggaaccacgaagaagagaaag
ttggaggaggaccagggaaagaaggcaaaagccaaggttgcgagtacggcgacgtcggca
tcaatacagacgaccggcacctggcaatcgacccaacaggctgccccagcaaaggccacc
cagtaccagaaagcccccgcccagccggctcagcagcagggtccaccaccgtgggatgac
cctgaaggccattacattgtcaagcctgacgatgttatcggcggtagatacaaaattgtc
aggttactgggtcaaggaacgtttggtaaggtggttgaagcaagacatattgagacacgg
cgtaaagtcgcgatcaaggttatccgggccgtgcaaaagtaccgtgaggcgagcaaaatt
gagatcagagtgcttgaaacgcttagaaagcatgatccacggaatgacaacaaatgtata
catctcgacgaatactttgacttccggaaccatccgtgtctcgtctcagagttgtacgga
atgagcgtatttgactttttaaagcagaacggtttccaaccatttccggataagcacatt
caagactttgcaaagagtttattaagaagcgtgtcctacttgcattctctcaagctcgtg
cacaccgatctcaagcccgagaatattcttttatgttcaaatgaggcgagattagcaggc
cctagagtccgaaatgctcgttcaaagtccatcctcaagaacactgaaatccgtcttatc
gattttggttctgccacttttgaatccgaatatcattcctctgtcgtctctactagacac
tatcgtgcccctgaaatcatacttggtctttcatggtcttatccttgtgacatgttcagt
ataggctgtatcctggtagagttctacactggaaacgcgctttttcagacgcacgacaat
ttggaacatttggcgatgatggaggttgtgatgggtaagtttagccagaggatgattgag
aagggaaagagtaaaaagccagagtactttaaaggcaacaagatagattttccaaactct
acggtttccaaggcgagcagaaaatatgtcaagagcatgcaaagcctaaagcaagtgatc
gatcctgccaacagacatcaacagttgttccttgacctttgtacgagactgctagagcat
gatccggacgtccggatcaaggtgcaagacgctttacgacatccttatctaaccgagcct
attccagagcctgcataa

DBGET integrated database retrieval system