KEGG   Cryptococcus neoformans JEC21: CNA06950Help
Entry
CNA06950          CDS       T00243                                 

Definition
electron carrier
Orthology
K08738  
cytochrome c
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CNA06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(1889066..1889090,1889227..1889258,1889336..1889479,1889591..1889611,1889678..1889708,1889773..1889846,1889901..1889909)
Genome map
AA seq 111 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWEGQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgcccaatgtcacacccttggtgctggtgaacctcacaaggttggccctaacctc
cacggtctcattggccgaaagtccggtcaagccgagggtttctcttacactgccgccaac
gtcaacaagggcgttacttgggaaggacaaaccctcttcgagtaccttgaaaaccccaag
aagtacattcctggtaccaagatggcctttgctggtctcaagaaggccaaggacaggaac
gacctcgtcgcccaccttgaggaggctaccaagtaa

DBGET integrated database retrieval system