KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA06950Help
Entry
CNA06950          CDS       T00243                                 

Definition
(RefSeq) electron carrier
  KO
K08738  cytochrome c
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 3253583
NCBI-ProteinID: XP_567012
UniProt: Q5KNC7
Position
1:join(1889066..1889090,1889227..1889258,1889336..1889479,1889591..1889611,1889678..1889708,1889773..1889846,1889901..1889909)
Genome map
AA seq 111 aa AA seqDB search
MAGDTYTPGDASKGAGIFKTRCAQCHTLGAGEPHKVGPNLHGLIGRKSGQAEGFSYTAAN
VNKGVTWEGQTLFEYLENPKKYIPGTKMAFAGLKKAKDRNDLVAHLEEATK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgacacttacactcctggtgacgcttctaagggtgctggtatcttcaagacc
cgatgcgcccaatgtcacacccttggtgctggtgaacctcacaaggttggccctaacctc
cacggtctcattggccgaaagtccggtcaagccgagggtttctcttacactgccgccaac
gtcaacaagggcgttacttgggaaggacaaaccctcttcgagtaccttgaaaaccccaag
aagtacattcctggtaccaagatggcctttgctggtctcaagaaggccaaggacaggaac
gacctcgtcgcccaccttgaggaggctaccaagtaa

DBGET integrated database retrieval system