KEGG   Cryptococcus neoformans JEC21: CNA07360Help
Entry
CNA07360          CDS       T00243                                 

Definition
ubiquitin-specific protease
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cne00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CNA07360
Enzymes [BR:cne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNA07360
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNA07360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(2011335..2011628,2011680..2013178,2013231..2013657,2013718..2014370,2014428..2014495,2014558..2014691,2014750..2015037,2015095..2015222,2015279..2015598,2015674..2015756,2015838..2015857,2015916..2015940)
Genome map
AA seq 1312 aa AA seqDB search
MTRPPSPPSFTGLPLSQLLQYASDDNGAGSHPPKVWFERACYNADKAKLAERKQSKEDMF
VSYSRACQSYINVAMHNDWPETKKKDPQLAARVKDFKPMYDSFVAKAKALKEELRHAEAS
SPAQSKPESSKPSVSRQRSGPEITSIGNIRDRMQALAGHGMEVETIQSKRLSREAPAKAP
KPAALSSVTNSAARSRSGSESRPLSTTTTNGRQLVVTASSKPPPTASQEKSPPSAPVNVQ
ANGSSSRSRRSTLTSEGQGMSVSVGSVAASPAQSPMPTPAAGPYRSPLPSIPSSPQPLPA
SHPPLPSPEPPRPNVPINSSDMESHPEDGLAEFERAFPSLSEFGKQWDGDSLQPDTNSND
MYHAPQYPKPPKQPPISEEDDIPDLPSLPSVPTFKPGLPPPPARPDAYAFSPPATSPSVQ
TRGQTPVPRGPSPPKPDVGSGVGLHRPASTPMPNIAGLDLIDMPDGDVPQGKAMNGGGKM
EALNSPEAVSRPPQYSDATSRPTPTTRHPLPQLPSRPPTSDAVQPTLKPKEKPKFPFSNS
ITPDELREYFLNPSVEMLFLDIRPEDEWKKGYVGREYEKRGARVEIVWLDPTVLLREGMT
ASKLEDALSLSPAVQREAFQNRHKYDLVIVYDTRSPVWPKDGPLNRIWDIFFMGHDEKRL
QRNPVILVGGYEKWREFIKMRAARHAHTAKGKDVREGVNGYAVMRSDVVSPAPSEISVKN
ANREAPVYQASQYAKSIAENFGAGPQSMTGDSYRPSTHSHSQSQLYTPTYRHHHSRTGST
YSSHGAIAAPPQASIHPGPGARRRSDYIEHTGQSYSGSASTSPSIQSTGTTPQPQQQYYA
SPSLPASNSVTPSISSMASPRASIDYPQAHALAKVPVPMPPPAVARPMERHDAYTSTHVH
AQSLVPTSSGYGQLPSQGQVTRSQAMRRMDTVPVGGKDKVGYWRDVVLGITGLKNLGNTC
YMNSTIQCLSATYPFSTFFLDGTFARSINKENPLGTKGELAKAWAELLRVLWSEKYEFLS
PMTFRKQITHFAPQFLGSDQHDSQEFLSFVLDGLHEDLNRVKRKPPPVEMTPEREAMLES
APPEVASEREWAIYRQRNDSLIVDLFQGQYRNRLECLTCHKTSTTYDAFMYMSLPVPSGK
TKVVIQELIDEFVKAEVMEKENAWYCPRCKTNRRASKTLTIARLPPVLLIQLKRFTTRDG
LFWDKSETPVIFPIRGLDLTRYLPGPAGSSIGSGRQVGPDGTFDPRAQVGPFKYDLYGVS
NHMGTLSSGHYTAFVKSKEGWKYCEDSQVMPAQEKDVISRPAYILFYKRVPG
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgactcggccgccgtccccgccatcgttcacagggctcccgctctcgcagctgctgcag
tacgcctcggacgacaacggcgcaggcagccacccgcccaaagtatggttcgaacgcgca
tgctacaacgccgacaaggcaaagttggcagagcgcaaacagagcaaagaggacatgttc
gtcagctacagcagggcgtgccagtcctatatcaacgttgcgatgcacaacgactggcca
gagaccaagaaaaaggatcctcagttggccgccagagtcaaggatttcaagccgatgtac
gattcatttgtcgcaaaggccaaggctttaaaagaggaacttcggcatgcggaggcatct
tcacccgctcagtccaaaccagaatcatccaaaccatcggtatcaagacaacgatctggg
cctgaaataacatcaatcggcaacatcagagatcgaatgcaggcacttgccggacacgga
atggaggttgagactattcagtcgaagcgcttaagtagagaggctcctgccaaagcgcca
aagcctgctgcattgagtagcgtgaccaactctgcggcaaggtctaggagtggcagcgag
tcgcgacctttgtccacaacaacgaccaatgggcggcaactcgtggtcactgcttcatct
aaaccaccaccaactgcgtcacaagagaaatcacctccatctgcacccgtcaacgtacaa
gccaatggatcgtccagcagatcacggcgatccactttgacgagtgaagggcagggcatg
agcgtatctgttgggtctgtggcagcttcaccggcgcaatcaccgatgcccacacctgca
gctggcccatacagatcgcccttaccctccatcccttcctctcctcagcctcttccagca
tctcatccgccattaccctctcccgagccaccacgaccaaatgttcccatcaactcgtcc
gacatggagtctcatcctgaagacggcttggcagagtttgagcgtgctttcccatctctc
tccgaatttgggaaacaatgggatggcgactcgttacagcctgacacgaatagtaatgat
atgtaccacgccccgcagtacccgaaacctccaaagcaaccgcctatctctgaagaagac
gatatcccagaccttccatctttaccttccgttccgacattcaagcccggcctgcctccc
cctcctgctcgaccggacgcatatgcattctcaccaccagccacttccccgtctgttcaa
actcggggacaaactcccgtcccccgcgggccatcacctcctaaacccgatgttggttcg
ggtgtcggtctgcatcgaccggctagtacgcccatgcctaatattgctggtttagatctg
atagatatgcctgatggggatgtacctcaaggaaaagccatgaacggtggtggaaaaatg
gaagctctaaattcccctgaggctgtatctaggcctccccaatattctgacgcaacatcc
cgtcctactccaaccacacggcatcctcttccccaacttccttctcgccctcccacctct
gatgccgtacagcctactctcaaacccaaggagaaaccaaagtttccttttagtaattct
atcactccggatgaacttcgcgaatactttctcaatccttcagtggagatgttgttcttg
gacataaggccggaagacgagtggaagaagggatatgtagggagagagtatgagaagaga
ggtgcgagggtggagattgtgtggctggatccgacagtcttgcttcgtgaaggtatgacc
gcgagcaaattagaagacgcactttccctttcccccgctgttcaacgcgaagcttttcag
aatcgacacaaatacgacctcgtcatagtctacgacactcgttctcccgtatggcccaag
gacggtcctttaaaccgaatttgggatatattctttatgggccacgacgagaagcgtttg
cagagaaatcccgtcattttggtaggaggttatgaaaagtggagagagtttatcaagatg
cgagcggctaggcatgcacatacggcaaaggggaaggatgtgagggagggggtgaatggg
tatgcggtgatgcgatcggatgttgtgtcccctgcgccttccgagattagtgttaagaat
gcgaacagggaagcaccggtctaccaggcatcacagtatgcgaagagtatcgctgaaaac
tttggcgctggaccccaatccatgacgggagactcgtaccgtccctccacacattctcac
tcccaatcgcaactctacacgcccacatacaggcatcatcactccagaacgggctcaact
tactcctcccacggcgctattgccgctcctccacaagcttccattcaccccggaccaggt
gccagacggcgaagcgactacattgaacatacaggtcaatcgtactctggctcagcctcg
acttccccctccatacaatcgactggcaccacacctcaacctcaacagcaatactacgct
tccccatccctccctgcttctaactccgtgacaccgtccatatcatccatggcctctcct
cgggcatcgatcgattaccctcaagcgcacgcattggcaaaggtaccagtcccgatgcct
cccccagccgtggcgagaccgatggaacgacatgatgcgtacaccagcacacatgtgcat
gcgcagagtttggtaccgacttcttccggttatggtcaacttccatcacaagggcaagtg
acgaggagtcaggcgatgaggcgcatggacactgtgcctgttggtgggaaggataaagtg
gggtattggcgggatgtggtgttgggtattaccgggttgaagaaccttggaaatacttgt
tatatgaactcgacaatacagtgtctcagtgcgacatacccattctctacgtttttcctt
gatggaacgtttgcacgttcaataaacaaagaaaatcccttggggacgaaaggcgagttg
gccaaagcctgggcagaattattgagagtattgtggagtgagaaatatgagttcttatca
cctatgactttccggaaacaaatcactcactttgctccccaattcctcggttctgaccaa
catgactctcaagaattcttgtcattcgtccttgacggcttacatgaggaccttaaccga
gtcaagcgcaaacccccccctgtggagatgactcccgaaagagaggcgatgctggagagc
gccccaccagaagtggcttctgagagagaatgggcaatctaccggcagaggaatgatagt
ttgattgtggatctgttccaggggcagtataggaataggttggagtgtttgacctgtcac
aagacatcgacaacttatgatgcgttcatgtacatgtctctgcccgttccatcgggtaaa
acaaaggtggttatacaagaactcattgacgaattcgtcaaggccgaagtgatggaaaag
gagaacgcctggtattgtcctcgctgcaaaaccaaccgtcgtgcttccaagacactaacc
atcgctcgtcttccacctgtactgctcatccaactcaaacgattcacaacgcgagacggt
ctcttctgggacaagtccgagacaccggtcatcttccccatcagaggtttagatcttaca
cggtacttgcctggacctgcaggttcgtcgataggaagtggaaggcaggtggggccggat
ggaacgtttgatccaagggctcaagtggggccgttcaagtatgatttgtatggtgtaagt
aatcatatggggacgctcagttcaggtcattatacggcttttgtgaagagtaaagaagga
tggaagtattgtgaggatagtcaggtgatgcctgcacaggagaaggacgtaatttcccga
ccagcatatatcttgttctataagcgagtacctggatag

DBGET integrated database retrieval system