KEGG   Cryptococcus neoformans JEC21: CNA07740Help
Entry
CNA07740          CDS       T00243                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNA07740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNA07740
   00620 Pyruvate metabolism
    CNA07740
   00640 Propanoate metabolism
    CNA07740
  Energy metabolism
   00680 Methane metabolism
    CNA07740
Enzymes [BR:cne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CNA07740
Lipid biosynthesis proteins [BR:cne01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CNA07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(join(2137516..2137544,2137601..2137733,2137784..2138800,2138851..2139032,2139080..2139120,2139174..2139320,2139388..2139591,2139648..2139937))
Genome map
AA seq 680 aa AA seqDB search
MGKTEVAPGVHHVHPLPDSVPESEDLFAPPPRMQGKEGRPKPHLGPNYEAYVNEWAKTVG
PNNDEWWAAKARETLDWYEDFKTVRAGGFEHGDIQWFPEGTLNAAYNCLDRHFYKNPKKT
AIIYEADEPSESREISYEELMQETCRVANVLKSYGVKKGDAVSIYLPMTWQAAAAFLACA
RIGAIHSAVFAGFSAESLRDRVNDCECKVLITTDEGRRGGKSIATKQIVDAALQQCPLVE
NVLVLRRTGNKVPMTEGRDKWWDEECAKMPAYCPCERMASEDPLFILYTSGSTGKPKGVV
HCTGGYLLGAALTLKYVFDAHPDDRFACMADIGWITGHSYIIYGPLANGITTAVFESTPV
YPTPSRYWDFVDKWKATQLYTAPTAIRLLRRMGEDHVKNHDLSSLRVLGSVGEPINPEAW
HWYNDFAGKNQCAIVDTYWMTETGSISIAPLPGAISTKPGSATFPFFGMDVDIIDPQTGQ
VLEGNDVEGVLVARKPWPSIARTVYRDHKRYLETYMKPYPGYFFFGDGAARDYDGYMWIK
GRVDDVINVSGHRLSTAEVESALILHKGVAETAVVGCADDLTGQAVYAFVTMKPEFDLKS
TKEADLSKELAIQVRKVIGPFAAPKKIYLVSDLPKTRSGKIMRRILRKIVAGEGDQLGDL
SSIADPQIVDEVKRKVTGSA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagacagaagttgcacccggcgtccaccacgttcaccctctccccgactccgtc
cccgagtctgaggacctcttcgctccccctcctcgtatgcagggcaaggaaggccgcccg
aagcctcaccttggtcccaattacgaggcctacgtcaatgaatgggccaagactgttggt
cccaataatgatgagtggtgggccgcaaaggccagggagactcttgattggtatgaggac
ttcaagactgtcagggccggtggctttgagcacggagacattcagtggttccccgaaggt
accttgaacgctgcttacaactgtcttgaccgacacttctacaagaacccgaaaaagacc
gccatcatctacgaggccgacgagccctctgagtcccgtgagatttcttacgaggagctc
atgcaggagacttgccgagttgccaatgtcctcaagagctacggtgtcaagaagggtgac
gctgtgtccatctatcttcccatgacttggcaagccgctgctgcgttccttgcttgtgcc
aggatcggtgccattcactctgctgtctttgccggttttagcgccgagagtttgagggat
agagtcaatgactgtgaatgcaaggttttgatcaccaccgacgagggtcgacgaggtggt
aagagtattgctactaagcaaatcgtcgatgccgctctccagcagtgcccccttgttgag
aacgttctcgtccttcgacgaaccggcaacaaggtccccatgactgaaggtcgtgacaaa
tggtgggacgaagagtgtgccaagatgcccgcttactgcccttgcgagaggatggcttcc
gaggaccctcttttcatcctctacacctctggttccaccggtaagcccaagggtgtcgtc
cactgcaccggtggttacctcctcggcgccgcccttaccctcaagtacgtctttgacgct
cacccggatgaccgattcgcctgtatggccgatatcggatggattaccggacatagttac
attatctacggccctctcgccaacggcatcaccaccgccgtctttgaatccactcccgtc
taccccacaccatccagatactgggactttgtcgacaaatggaaggctactcagctctac
actgcgcctactgcgatccgattgttaagacgtatgggcgaggaccacgtcaagaaccac
gatctcagctctctccgagtgttgggctctgttggtgagcccatcaaccccgaggcttgg
cattggtacaatgactttgcgggcaagaaccaatgtgccattgttgatacttactggatg
accgaaactggttccatctctattgctcctctccctggagccatctccaccaagcctggt
tccgccaccttccccttcttcggtatggatgttgacatcattgaccctcaaactggtcag
gtcttggagggtaacgatgtggagggtgttctcgttgccaggaagccatggcctagtatt
gccaggaccgtctacagggaccacaagaggtaccttgagacttacatgaagccttacccc
ggctacttcttctttggtgacggtgctgcccgagactatgacggttacatgtggatcaag
ggacgagttgatgatgttatcaacgtgtctggccaccgactctccaccgccgaggttgag
tctgcccttatcctccacaagggtgtcgccgagactgccgttgttggatgcgctgatgac
cttaccggtcaggctgtgtacgctttcgttacgatgaagcccgagttcgatttaaagagt
accaaggaggcggatcttagcaaggagttggctatccaggttaggaaagttattggtcct
ttcgctgctcccaagaagatttaccttgtttccgatctccccaagacccgatcagggaaa
atcatgcgtcgaattctccgaaagattgtcgctggcgagggtgaccaactgggagatctt
tcttccattgctgacccccaaattgtcgacgaagtcaagcgaaaggttaccggctctgct
taa

DBGET integrated database retrieval system