KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA07780Help
Entry
CNA07780          CDS       T00243                                 

Definition
(RefSeq) nicotinamidase
  KO
K01440  nicotinamidase [EC:3.5.1.19]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00760  Nicotinate and nicotinamide metabolism
cne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CNA07780
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CNA07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 3253617
NCBI-ProteinID: XP_567125
UniProt: Q5KN44
Position
1:complement(join(2147566..2147752,2147808..2147901,2147977..2148016,2148101..2148292,2148352..2148516))
Genome map
AA seq 225 aa AA seqDB search
MASMPASTALIIVDVQNDFLPPTGSLAVPNGREVLPVITGLLDRKWDWAVVVVSQDYHPK
GHISFASAHPPNQAYTQLPLVNAHGESYIQTLWPDHCIQGTAGADLESGLAEVLAKRGDG
IHSKLEAYSAFQEIVPPKTSELAEFLLAQGVNKVVIAGVATDFCVLQTALSSISSSFPTL
LIAPAMRAISPEYEAKTFEAVESLGGVILGRNGEEWKTKLAEWIR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatgcctgccagcacggcactaatcatcgtagacgttcaaaacgactttttg
ccgcccacggggtctttggcagtgccaaacgggagagaggttttgcccgtaataactgga
ctgctcgaccggaaatgggactgggcagtggttgtagtgagccaggactatcatccaaag
ggtcatatatcgtttgcttcggctcacccacccaatcaggcatatactcagttgccattg
gtcaacgcccacggagagtcttacatacagacgctatggcctgatcactgtatacaaggt
actgccggtgcagacctcgaatctgggttggcagaggtactggcgaagagaggcgatggc
atccacagtaaactcgaagcgtactctgcttttcaggagattgttcctcccaaaacttcc
gaattggcagaatttttactggctcaaggtgtcaacaaagtggttatcgcaggagtagct
acagacttttgtgtccttcaaaccgcactgtcttcaatatcatcatctttcccgaccctt
cttattgcccctgccatgcgggcaatctctcccgagtacgaagctaaaactttcgaggcc
gtcgagtcccttggaggggtcatccttggacgaaatggagaagaatggaaaacaaagctg
gctgaatggatccgataa

DBGET integrated database retrieval system