KEGG   Cryptococcus neoformans JEC21: CNB00560Help
Entry
CNB00560          CDS       T00243                                 

Definition
histone h2b
Orthology
K11252  
histone H2B
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(162566..162649,162707..162828,162884..163027,163078..163147)
Genome map
AA seq 139 aa AA seqDB search
MAPKSVASKAPASQASKAPAAASKAPAKAAKTSAAPKDGAKKRSKKRVESYSSYIYKVLK
QVHPDTGISNKAMAILNSFVSDIFERIATEASKLASYNHRSTISSREIQTSVRLILPGEL
SKHAISEGTKAVTKYSSSK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagtctgttgcttccaaggctcctgcttcccaggcctccaaggcccccgct
gccgcgtccaaggctcccgccaaggccgctaagacttctgctgctcccaaggacggtgcc
aagaagaggtccaagaagagggtcgagtcttactcttcttacatctacaaggtcctcaag
caggtccaccccgacactggtatctctaacaaggccatggctatccttaactctttcgtc
tctgacattttcgagcgaattgccactgaggcttccaagcttgcttcttacaaccaccga
tctaccatctcttctcgagagatccagacctctgtccgactcatccttcctggtgaactc
tctaagcacgccatctctgagggtaccaaggctgtcaccaagtactcttcttccaagtaa

DBGET integrated database retrieval system