KEGG   Cryptococcus neoformans var. neoformans JEC21: CNB00990Help
Entry
CNB00990          CDS       T00243                                 

Definition
(RefSeq) 2-oxoglutarate metabolism-related protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00020  Citrate cycle (TCA cycle)
cne00310  Lysine degradation
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
Module
cne_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cne_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNB00990
  Amino acid metabolism
   00310 Lysine degradation
    CNB00990
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CNB00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 3256093
NCBI-ProteinID: XP_569105
UniProt: Q5KMP3
Position
2:complement(join(298937..298995,299051..299205,299255..299349,299407..299787,299846..300217,300288..300386,300441..300466,300515..300588,300686..300792))
Genome map
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPRANIVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAGKEKGAGEEA
LAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKAVGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacgtcctcccgcgccatcgcttcctcttccactgccgcccttagacgatca
agtcttcggtccatctctcttgccaggaacgtctccaaaactcagatctctcgcactgct
cttcaacctcgggccaacattgttttccgttccagtttccactcttcatctctcctcctc
gcggagaccgtcaaggttccacagatggctgagtccatcacggaaggcactctgaaacaa
tggagcaagcaagtcggtgattttgtcaaacaagacgaggagattgctaccattgagacc
gacaagattgatgtctcagtcaacgctcctgtttccggtactatcactgaactccttgcc
gaggaggaatctactgtcactgttggccaagatcttctgaagattgaaccgggagagggt
ggcgctcagtcctcagagtccaagcctcaagccaagtctgagcctaagaatgctgaagaa
ggcaacaaggacgaagcggcccctgccgctggcaaggagaagggagccggtgaggaggca
ctcgccaagcatgaggaaaaggcgcccaagttggacaaggctgaggctgaaaagcctgct
ccaaagaaacaggagaagccttcccctaagcaggagcctcaacctgagaaggctgttgga
agcaggaatgaaaccagggtcaagatgtcccgaatgcgacaaactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactaccttcaacgaaattgacatgtcttcc
cttatggaattccgaaaactttacaaggatggcgtcctgaagaacgagggtgtcaagctt
ggtttcatgtctgcttttgccaaggcctcttgtcttgcccttaaggaaattcccgccgcc
aatgctagcattgaaggcgactccatcgtttacagggactatgttgacttgtctgtcgcc
gttgccactcctaagggtctggtgactcccattgtcaggaacgcggaaagcatgggtctc
gtcgagattgaaaaggcgattgctgatttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggcggtactttcaccatctccaatggtggcgtcttcggttctctt
tacggtacccccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgttatccggcctatcatggttgttgctctt
acatatgaccatcgattactcgacggccgggaagccgtcactttcctcgttcgtatcaag
gaatacattgaggactccaggaggatgttgcttccgtcccctatctaa

DBGET integrated database retrieval system