KEGG   Cryptococcus neoformans JEC21: CNB00990Help
Entry
CNB00990          CDS       T00243                                 

Definition
2-oxoglutarate metabolism-related protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNB00990
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CNB00990
  Amino acid metabolism
   00310 Lysine degradation
    CNB00990
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CNB00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(298937..298995,299051..299205,299255..299349,299407..299787,299846..300217,300288..300386,300441..300466,300515..300588,300686..300792))
Genome map
AA seq 455 aa AA seqDB search
MIRTSSRAIASSSTAALRRSSLRSISLARNVSKTQISRTALQPRANIVFRSSFHSSSLLL
AETVKVPQMAESITEGTLKQWSKQVGDFVKQDEEIATIETDKIDVSVNAPVSGTITELLA
EEESTVTVGQDLLKIEPGEGGAQSSESKPQAKSEPKNAEEGNKDEAAPAAGKEKGAGEEA
LAKHEEKAPKLDKAEAEKPAPKKQEKPSPKQEPQPEKAVGSRNETRVKMSRMRQTIAQRL
KASQNAAASLTTFNEIDMSSLMEFRKLYKDGVLKNEGVKLGFMSAFAKASCLALKEIPAA
NASIEGDSIVYRDYVDLSVAVATPKGLVTPIVRNAESMGLVEIEKAIADLGKKARDNKLS
IEDMSGGTFTISNGGVFGSLYGTPIINLPQAAVLGMHTIKEKPVVVNGQIVIRPIMVVAL
TYDHRLLDGREAVTFLVRIKEYIEDSRRMLLPSPI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggacgtcctcccgcgccatcgcttcctcttccactgccgcccttagacgatca
agtcttcggtccatctctcttgccaggaacgtctccaaaactcagatctctcgcactgct
cttcaacctcgggccaacattgttttccgttccagtttccactcttcatctctcctcctc
gcggagaccgtcaaggttccacagatggctgagtccatcacggaaggcactctgaaacaa
tggagcaagcaagtcggtgattttgtcaaacaagacgaggagattgctaccattgagacc
gacaagattgatgtctcagtcaacgctcctgtttccggtactatcactgaactccttgcc
gaggaggaatctactgtcactgttggccaagatcttctgaagattgaaccgggagagggt
ggcgctcagtcctcagagtccaagcctcaagccaagtctgagcctaagaatgctgaagaa
ggcaacaaggacgaagcggcccctgccgctggcaaggagaagggagccggtgaggaggca
ctcgccaagcatgaggaaaaggcgcccaagttggacaaggctgaggctgaaaagcctgct
ccaaagaaacaggagaagccttcccctaagcaggagcctcaacctgagaaggctgttgga
agcaggaatgaaaccagggtcaagatgtcccgaatgcgacaaactattgcccaacgtctc
aaggcgtcccaaaatgcggccgcttcccttactaccttcaacgaaattgacatgtcttcc
cttatggaattccgaaaactttacaaggatggcgtcctgaagaacgagggtgtcaagctt
ggtttcatgtctgcttttgccaaggcctcttgtcttgcccttaaggaaattcccgccgcc
aatgctagcattgaaggcgactccatcgtttacagggactatgttgacttgtctgtcgcc
gttgccactcctaagggtctggtgactcccattgtcaggaacgcggaaagcatgggtctc
gtcgagattgaaaaggcgattgctgatttgggtaagaaggctcgagacaacaagcttagc
atcgaggacatgtccggcggtactttcaccatctccaatggtggcgtcttcggttctctt
tacggtacccccattatcaacttgcctcaagctgccgtgcttggtatgcacactatcaag
gagaaacctgtggtggtgaatggccaaatcgttatccggcctatcatggttgttgctctt
acatatgaccatcgattactcgacggccgggaagccgtcactttcctcgttcgtatcaag
gaatacattgaggactccaggaggatgttgcttccgtcccctatctaa

DBGET integrated database retrieval system