KEGG   Cryptococcus neoformans JEC21: CNB01150Help
Entry
CNB01150          CDS       T00243                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNB01150
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CNB01150
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CNB01150
Enzymes [BR:cne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CNB01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(349412..349474,349527..349558,349609..349986,350036..350831,350887..350996,351046..351310)
Genome map
AA seq 547 aa AA seqDB search
MDQEMRYFSTRGGKETLSFEDAVLTGLAPNGGLYIPTHIPALPKDWKTKWAGLSFPELSH
EILSLFVPTSVIPSDDLQSIINTAYSSFRSPATTPIRQTGDKEYVLELWHGPTWAFKDVA
LQFLGELFRYFLERRNKGKTEDMEELTVVGATSGDTGSAAIYGLRSKPSITIFILYPDGR
VSPIQEAQMATVLDANVYCVAVEDSDFDTCQSIVKTLFSDAQFNATHRLGAINSINWARI
LAQIVYYFSAYFQLPEEARKDGAKLQFVVPTGNFGDILAGWYAKKLGLPMQQLVVATNEN
DILERFFRTGRYEADDPVQQDQTAETAAVNGSSDGQQAVSAVKATHSPAMDILLSSNFER
LLYYLALETNGTEGSDEEKRLKAQEKLNGWMSALKKDGKVDLGEDVRQAAGKDFWAERVS
DGQTLEEIQKYYRREKYGPYVVDPHTAVGLTAQERSAKKASSDTTWITLSTAHPAKFSGA
VELALSASEFPDFDFRRDVLPDELKKLEGLEKRVHRVKGEEGVRALIEKVKSASHEKVDA
EEGRGSL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggaccaggaaatgagatacttctccacaagaggtggcaaggagaccctctccttcgag
gacgccgtcttgaccggtctcgctcccaacggaggtctctacatccccacccatatccct
gcccttcccaaggattggaagaccaaatgggccggtctgtctttcccagagctctcccac
gaaatcctctctcttttcgtccccacctctgtcattccctccgacgacctccagtccatc
atcaacactgcctacagctccttccgatcgcccgccactacgcccatcagacagactggt
gacaaggagtacgttctcgagctctggcatggccccacatgggctttcaaggacgtggcc
cttcagttcttgggagagttgtttaggtactttttggagaggaggaacaagggcaagact
gaggatatggaggaattgaccgttgttggtgccactagtggcgacactggaagtgctgcc
atctacggtctccgatccaagccctccatcaccatcttcatcctctaccccgatggccga
gtgtcccctatccaggaggctcagatggccactgtcctcgacgccaacgtttactgcgtc
gccgttgaggactctgactttgacacttgccaaagcatcgtgaagacgctcttctcggac
gcccagttcaacgctactcaccgtcttggtgctatcaactcgattaactgggcccgtatc
cttgctcagatcgtctactacttctccgcctacttccagcttcccgaagaggccaggaag
gacggtgccaagcttcaattcgtggtgcccactggtaactttggtgacatccttgctggg
tggtacgccaagaagcttggtctccccatgcagcaactcgtcgtcgctaccaatgagaac
gacattctcgagcgatttttcaggaccggcaggtacgaggctgatgaccctgtgcaacaa
gaccagactgccgagactgctgctgtcaacggctctagcgacggacagcaggctgtcagc
gccgtcaaggcgactcactctcccgctatggacatcctcctctcttccaactttgagagg
ctgttgtactaccttgcgcttgagaccaacggcaccgagggctccgatgaggagaagagg
ctcaaggcccaggagaagttgaacggctggatgagcgctttgaagaaggatggcaaggtc
gacctgggagaggatgtcaggcaggctgctggcaaggacttttgggccgagagagtatct
gacggtcagacgctcgaggagatccaaaagtattacaggcgtgagaagtacggtccttat
gtcgttgacccccacactgccgtcggtcttaccgctcaggagcgctctgccaagaaggcc
tcctccgataccacctggatcactctgtctactgcgcaccctgccaagttctccggtgct
gttgagctcgctctctcagcctccgagttccccgactttgacttccgacgggatgtgctc
ccggacgagctcaagaagctggagggtcttgagaagcgagtgcacagggtcaagggcgag
gagggtgtgcgtgcgttgattgaaaaagtgaagagtgcgagccatgaaaaagtagatgcc
gaagagggacgagggtctctttaa

DBGET integrated database retrieval system