KEGG   Cryptococcus neoformans JEC21: CNB02030Help
Entry
CNB02030          CDS       T00243                                 

Definition
protein phosphatase type 1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    CNB02030
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CNB02030
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CNB02030
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     CNB02030
Transcription machinery [BR:cne03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     CNB02030
Spliceosome [BR:cne03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    CNB02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(590315..590369,590429..590560,590618..590848,590901..591077,591129..591280,591333..591467,591517..591574,591939..591985)
Genome map
AA seq 328 aa AA seqDB search
MGEQPEIDLDSVIDRLLEVRGNRPGKAVQLAEYEIKYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
QSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLLCSFQILKPAE
KKPKYGGYGGSARPVTPPRKGKSNKRKA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggagaacagcctgaaattgatcttgactcagtcatcgaccgactgttagaagtgcga
gggaacagaccaggcaaggcagtgcagttggcagaatacgaaatcaaatacctttgcacc
aaagcccgtgaaatcttcatcagtcagccgatcctccttgaactcgaagctcctatcaaa
atctgtggtgacatccatggacaatattacgacttgttgcgtctctttgagtacggtggt
ttcccccccgaagccaattatctcttcctcggtgactatgtcgaccgaggcaagcaatcc
cttgaaactatctgcctgctgttggcgtataaaatcaagtaccctgaaaactttttcatc
ttgagaggaaaccatgaatgcgcgagtatcaataggatctatggattctatgatgaatgc
aagcgtcgctacaacatcaagctttggaagacttttaccgactgcttcaactgtctcccc
atcgctgctatcatcgacgagaaaatcttcacaatgcacggaggtttgagtcctgacttg
caaagtatggagcagatcaggagagttatgcgaccaacagatgttccagacaccggtctt
ctttgtgacctgctttggtctgatccggacaaggacatcactggatggagcgagaatgat
cgaggagtctcgttcacttttggtccggacgttgtttctcggttcttgcaaaagcacgat
atggacttgatttgtcgagcgcatcaagttgttgaagacggctacgaattcttcgccaag
cgacagcttgtcactctattctctgcccctaattattgtggcgaatttgataatgctggc
gcgatgatgagcgtagacgacaccttactttgttccttccaaattctgaaacctgccgaa
aagaagccgaaatacggtggatacggcggaagcgcacggccggttactcctccacgtaaa
ggcaagtcgaacaaaagaaaggcgtga

DBGET integrated database retrieval system