KEGG   Cryptococcus neoformans JEC21: CNB03160Help
Entry
CNB03160          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNB03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(955130..955307,955363..956777,956837..956938))
Genome map
AA seq 564 aa AA seqDB search
MSPSAPSTPHGRGSGSEPGTPAPSVAAGGSYTIDDVVPGVKIYVIKPLSNGQAEQRRAEI
LSTRPKPKPSAFAPPPPPNAPSPDPRDDTEYYVHYVEFNKRLDEWVGGSRLVLSKEMEWP
KSKDEPKKKDRPAKAQPSKAPSRATGSPIPSDSLLKKAANKAAMAAGKATPGKAMPSSKL
GKASKIGKAGKFPQKRKAKTEADTEAEEESNEDNDALGEEEDMDEDGDVTLITSDGAIDP
SREVVAAPSNPRAAPQVFSKKQEIEKLRTSGSMTQSHSEISRVKNLNKLQIGKHEVETWY
FSPYPIEYAHLPVLYICEFCLLYYPSATQLRRHRAKCTLLHPPGNEIYRHEGISFFEIDG
RKQRTWCRNLCLISKCFLDHKTLYYDVDPFLYYCMTVKDDYGCHLIGYFSKEKESAEGYN
VACILTLPQHQRKGYGRLLIEFSYELSKVEGKLGSPEKPLSDLGLLGYRAYWQEKIVELL
LDSDYEISLDEIAQKTSITHGDIMHTCQALQMIKYYKNSHIIHLTDAVIEQHKKTKAKPR
RAINPAYLKWKPPVFSRAQLAFGF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcagcaccgtcaactcctcatggtcgagggagtggtagcgagccgggtact
ccggcaccttctgtggccgctggaggatcatatacaattgatgatgtcgttcctggggtc
aaaatctatgtcattaagcctctttcgaacggccaagccgagcaacgcagagcggaaatt
ctttccacccgtcctaaacccaaaccttcagcctttgcgcctccaccgcctcctaatgca
ccctcccccgacccaagagacgatacagagtactacgttcattatgtcgagtttaataaa
cgtttagatgaatgggtcggcggaagcagactggtgttgagtaaagaaatggaatggcca
aaatcaaaggatgagccgaagaaaaaggacagacctgcgaaagctcagccttctaaggcc
ccgtctagggccaccggttcacctattccttccgatagtctactgaaaaaggcggcgaat
aaggctgctatggctgcaggtaaagctactccagggaaagctatgccttcttcgaaactt
ggaaaagctagcaagattgggaaagctggcaaattccctcaaaaacgaaaggctaagaca
gaagcggacacagaagcagaagaggagagtaatgaggataatgatgctttaggcgaggaa
gaagacatggacgaagacggcgatgtgaccttaatcacatcagacggcgccatcgatccc
agccgtgaagtcgttgccgccccttcaaatccccgtgcggccccccaagtgttttccaaa
aaacaagaaatcgaaaaactgaggacatctggatccatgacacagtctcattcagagatc
agcagggtcaaaaaccttaacaagcttcaaatcgggaagcatgaagttgagacatggtat
ttctctccttatccgattgaatacgcacatcttcctgttctttacatctgcgaattctgt
cttctctactatccttctgccacacaactcaggcgacatagagcgaaatgtactctcctg
catcctccaggcaacgaaatttaccgccacgaaggtatttcattcttcgaaatcgatggt
cgaaaacaacgcacttggtgcaggaatctatgtctcatctccaaatgcttcctcgaccat
aaaaccttgtactacgatgtcgatccttttctttattattgtatgacggtcaaagatgac
tatggctgtcatcttattggttacttttcgaaggaaaaggagtcagccgagggttataat
gttgcctgtattctgactttacctcaacaccagagaaagggttacggtcgacttttgatc
gagttctcatacgagctgtcaaaagtggaaggaaagctggggagccccgagaagccttta
tcggatctgggcttgttgggttatcgagcgtattggcaggagaagatcgtcgaattgcta
ctggacagtgattatgagatcagtctggacgaaattgcccaaaaaacatcaatcactcat
ggcgatattatgcacacttgtcaggccctacagatgatcaaatactacaagaacagtcat
attatccatctgacggatgctgttatcgaacaacacaaaaagacaaaagctaaacctcgg
cgcgccatcaaccccgcatatttgaaatggaagccgccggtctttagtagagcacaattg
gcgtttggtttttaa

DBGET integrated database retrieval system