KEGG   Cryptococcus neoformans JEC21: CNB03250Help
Entry
CNB03250          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CNB03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(982463..982642,982704..982957,983017..983159,983211..983278,983347..983400,983482..983517))
Genome map
AA seq 244 aa AA seqDB search
MAWLSSGRTNVELIENMKSSGLIHSSRVAAAMMKVDRKHYVPLRTFAYEDSPQKIGFGAT
ISAPHMHAHACENLLELLPQTQNGGEEPPRILDVGSGSGYLTAVFHYLSPKSLVVGIDHI
QGLVSQSIRNLADDGVKVLDKHNVEGGGVLMLCGDGRKGSKEYAPFTVIHVGAAAPEFPD
ELVDQLAKPGRMFIPVGKGSQGLHFPQNFQARFLIDELDVWQVDKSANGDVTKKKLFGVM
ASAV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcatggttatcaagtgggcgcaccaatgttgaacttattgagaacatgaaaagctct
ggcttaattcactcttctcgggtggcagctgctatgatgaaggtggatagaaaacactat
gtaccacttcgtacatttgcctatgaggattcccctcagaaaatcggatttggagcaact
atatccgctcctcacatgcatgctcatgcatgtgaaaacctccttgagctcctgcctcag
acccagaatggtggggaagagcctcctcggatcttggatgtgggaagcggatctggttac
ttgacggccgtctttcactatctatcacccaagtctctagttgttggcatagatcatatt
caaggtctggtatctcaatcgatacgcaaccttgccgatgatggagtcaaagtcctcgac
aagcataatgttgaaggcgggggggttctgatgctttgcggtgatgggcgaaaaggatca
aaagaatatgctcccttcacggtcattcacgttggagcagctgctccagaatttcctgac
gagttggtagaccaactagccaagcctgggaggatgtttattcctgttggaaaaggatca
caaggtttgcattttcctcagaactttcaagcaagatttctgatagacgagttagatgtg
tggcaagtcgacaagtcagctaacggtgacgtgaccaagaagaaactgtttggagtcatg
gcaagtgcagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system