KEGG   Cryptococcus neoformans JEC21: CNB04920Help
Entry
CNB04920          CDS       T00243                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNB04920
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CNB04920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(1406923..1406964,1407018..1407120,1407177..1407349,1407399..1407703,1407760..1408444))
Genome map
AA seq 435 aa AA seqDB search
MPSTTDPLADSRASPQSPRSIPTANLNNLSLLSESSTGSWERGRMAGNARSPPTNSILAD
SLAAGVAPVAAGVNVVEGGNDLSPSSGAKSLRSGGAYPQPQRPWPADKGLSRPNPATGRV
SFPSVPQYARQAREGYGFRPRSGQTTPTTGAEASLTYPFPSTSSSRVPRPKEDDDDLDHR
PDGKSMDELRGEVREELDKQGLVQAAKGVVEPHMGISGIADEEGLGWPAKSTHLRLHSTP
EEKSANMELLTSALRTVLECIGEDPDREGLQRTPERYAKALLWMTKGYEERLVDVINDAV
FAEDHDEMVIVRDIEVFSLCEHHLVPFTGKISIGYIPSKLVLGLSKLARIAETFSRRLQV
QERLTKQVALAVEEAIRPRGVAVVMEASHMCMSMRGVQKPGATTVTSTMLGCFRQQQKTR
EEFLTLIRTPSAARH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccttccacaactgaccctctcgccgactcccgcgcatcccctcagtctccccgttct
atccccaccgccaacctcaacaatctctctctcctttccgaatcctctactggttcttgg
gaacgcggcaggatggcgggcaacgctcgttcaccgcctacaaattctatccttgccgac
tcgctcgcagctggtgttgctcccgtagcggcgggtgtaaatgtggtcgaaggcggtaac
gacttatccccatctagtggagccaaaagtttgaggtctggcggagcctaccctcaacct
caacgtccttggcccgctgacaagggcctttcccgtcctaaccctgctactggtagggta
tccttcccgtctgttccccagtatgctcgtcaggcgcgtgaaggctacggcttccgcccc
aggtctggtcagactacccctaccaccggtgcggaagctagtttgacttatcctttcccc
agtaccagctcttctagagttccaaggcccaaagaggatgacgatgatcttgatcataga
ccggatgggaagtcaatggacgaattgaggggcgaggtcagggaagaactggataaacag
gggttggtgcaggctgccaaaggggttgttgaacctcacatgggtatctctgggattgct
gatgaagagggtctcggatggcctgccaagtccacacatctccgtctgcactccaccccc
gaagagaagtccgccaacatggagctcctcacctctgctcttcgaaccgtgcttgaatgc
attggtgaagaccctgaccgggaaggattgcaacgtaccccagaaagatatgccaaagct
ttgttgtggatgactaagggttacgaggagaggcttgtagatgtaatcaacgatgcagtc
tttgcggaagaccacgatgagatggttatcgtgagggatattgaggtatttagtctttgc
gagcatcacttggttcctttcactggaaagatttctattggctatatccccagcaagctt
gttttgggtctttccaaactcgctcgtatcgccgaaactttctcccgtcgtcttcaagtt
caagaacgtctcacaaagcaagttgctcttgctgttgaagaggccatccgccctcggggt
gtcgctgttgtgatggaggcttcgcacatgtgcatgtctatgagaggcgtccagaagccc
ggcgcgaccactgtcaccagcaccatgttgggatgtttcaggcagcagcaaaagacgcga
gaggagttcttgaccctcatccgtactcccagcgctgccagacactaa

DBGET integrated database retrieval system