KEGG   Cryptococcus neoformans JEC21: CNC02060Help
Entry
CNC02060          CDS       T00243                                 

Definition
histone deacetylase 1-1 (hd1)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CNC02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(576723..577318,577370..577521,577577..577666,577717..577800,577858..577933,577985..578093,578151..578243,578300..578441,578490..578628,578684..578758,578825..578942,579030..579335))
Genome map
AA seq 659 aa AA seqDB search
MSSAAIHPPLDFSPVRPDGRRVAYYYDHDVGNYHFGLGHPMKPHRIRMTHNLVVNYGLAD
DYEAMEEEGRRKVNARMGMENDEARWVNAEMRGSRAKRMQIFRPRRATKTDMTRFHTDEY
IELLESVLPENADALTGNRSRGLTGSDCPAVEGIFEFSSISAGGSIGAAEKLNEGIADIA
INWAGGLHHAKKTEASGFCYVNDIVLGILELLRVNSRVLYIDIDVHHGDGVEEAFYSTDR
VMTCSFHLFGNFFPGTGTLKDVGLGKGKGYAVNVPLREGITDEGFHSIFKPVIAEIMEHY
RPCVVVLQGGADSMSGDKLGRLNLSDKGHAECAKFLRTFSVPLMLLGGGGYTTKNVARAW
TRETAIACGQELSEDLPSNQYMEYYGPRYKLEVLPSNVEDFNTPEYLEDLKRQISNHLKN
LPFAPSAQMRQITGSNVSQAVGLSNEWETDDPEDQIDQRLKKLFASKNLNGTYTQESDAL
LSDLTSISRIRRQGGPKKLPRSSGTCGRARKRYLEDIAMGEDPCCLLPAMTSKKNERKTI
AKSGSSAPPTSAPEWHAHLTVHEMKSRPSLGEILQQPSPGSEDECDRNRCITEGSQLHMI
AQGRGKRSFFSRKGLPPSIISPQAIIGGSTVKVDRLIRARMAAATNNSPVVVEWDRQQE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggctgctattcatcctcctctcgacttctcgcccgttcgcccagatggccgg
cgcgtagcttactactatgaccacgacgtaggcaactaccattttggactcggccatcca
atgaagcctcatcggattagaatgacacataaccttgtagttaactatggactggccgac
gactatgaagctatggaggaagagggcagaagaaaggtgaatgctcggatggggatggag
aatgatgaagcaagatgggtgaatgccgagatgcgagggtcgagagcaaaacggatgcag
atctttagacctcgtcgagcaaccaaaacagatatgacgagattccataccgatgagtac
atcgagctgcttgagagcgtactaccggaaaatgcggatgctctcactggaaataggtca
agaggcttaactgggtccgattgtccggcagtcgaaggtattttcgaattcagctctatt
tctgcaggtggatccattggtgctgctgagaagctcaatgaaggtatagccgatatcgca
atcaattgggctggtggcctacaccacgccaaaaaaactgaagctagtgggttttgttac
gtcaacgatattgtcctaggaatcctcgaacttttgcgagttaactcgcgggtgctctac
atcgatatcgatgtacatcacggcgacggagttgaagaagcgttttactctacagacaga
gttatgacttgttcttttcatctctttggtaacttcttcccaggaactgggactctcaag
gatgttggcctgggtaaaggtaaaggctacgccgtcaatgttccactgagagaaggtatc
acagacgaagggtttcacagcatctttaaacctgttattgccgaaatcatggagcattac
cgcccatgtgtggttgtattgcaaggcggagcggacagtatgtcaggagacaagttaggg
aggttgaacctgtcggacaaagggcatgctgagtgtgccaagtttttgaggactttcagt
gtaccattgatgttacttggtggcggggggtatacgacgaaaaatgtggcaagggcgtgg
actagagaaacggctatcgcatgtggacaagagctatcggaagatttaccaagcaatcaa
tatatggaatattacgggcctcgatacaaactagaagtattaccttccaacgttgaagat
ttcaatacaccagaatatctcgaggatcttaagcgccagatttccaaccacttgaaaaat
ctccctttcgctcctagcgctcagatgcgacaaattactggtagcaatgtgagtcaagca
gtagggcttagcaatgaatgggagacagacgatccggaggatcaaattgatcagagactc
aaaaaactgttcgcaagtaagaatctgaacggtacctatactcaagagagtgacgctttg
ttgagtgacttaacaagcatttcaagaattagacgccaaggtggtcccaaaaaactgcct
aggtcttcaggaacatgtggcagagcaaggaaacgatatcttgaagatattgcgatggga
gaagatccttgttgtcttctgcctgccatgaccagcaaaaaaaatgagagaaaaacgatt
gcgaagagcggaagttcagcgcctccaacatcagcgccagaatggcacgcacatttaacc
gtgcatgaaatgaaaagcagacctagtctaggtgagatccttcagcaaccgtcgccaggc
agtgaggacgaatgtgatcggaatcgttgtatcactgaggggtcgcagctacatatgata
gcgcagggaaggggaaaaaggagtttcttttcgcgcaaaggtctgccaccctcaattata
tctcctcaggcgataataggaggatcaacggtaaaagtcgacaggctgatcagagcgagg
atggcggcggcgaccaataattctccggtagtggtggaatgggatcgacaacaggagtaa

DBGET integrated database retrieval system