KEGG   Cryptococcus neoformans JEC21: CNC02350Help
Entry
CNC02350          CDS       T00243                                 

Definition
MAP kinase kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CNC02350
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CNC02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(673131..673292,673333..673398,673456..673848,673902..674026,674117..674238,674289..674443,674494..675000))
Genome map
AA seq 509 aa AA seqDB search
MHPQNSSTPSTNSPSTFSLPKSSISRKKPPGLDISKSILRPTRTAPVLPANGSSPSNFVS
EADRLRDDIANLQLSSRSTGSNHSPEALDSPRAFQSDSSVASGLAKKEKSRDGKERGDKE
KRKKKHKDKDGEDLVKDEDLEILHDLGAGNGGTVTKVWNKKRKCVMARKLILVDAKPSIR
KQILRELQIMNDCDSPYIVGYYGCFPVDVHVGIVMEFMDAGSLDYIYRHHGAIDIDIVGK
VAQAVLEGLIYLYDKHRIIHRDIKPSNVLANTRGEIKICDFGVSGELINSIANTFVGTST
YMSPERIQGAPYTIKSDIWSLGISLIELAVGRFPFSDSPDSEELSPSVSDFDPDPTLPRS
VRRPKIESNSRHNGVSQSGGPHAMSILDLLQHIVNEPAPRLASRRRRFPQEAVAFVEGCL
IKDPDQRRSPKELLSSSWITNLKTTKEDLQTWAQSMIIFRLRIFFNVDTLLCISLITISH
IPVHHMPCVYLLLMTISSADEEMMHVWLM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcacccacaaaattcctcgactccttcaaccaactccccttccaccttctctcttccc
aaatcatccatctcacggaagaaacctccaggactcgacatctccaaatcgatccttcgt
cccacacgtacagcacccgttttgcccgcaaatggaagctcccctagcaactttgtgtca
gaagcagacaggctgagagatgacattgccaacctccagttgtcaagtcgatcaacaggc
tcgaatcactccccggaagcacttgactcccctagggcattccaaagcgacagttcggtt
gcgtcgggtcttgcaaagaaggagaagagcagggacggtaaagaacggggagataaggag
aagaggaagaagaaacacaaggacaaggacggagaagacttggtcaaggatgaagacctg
gaaatactgcacgatttaggagcgggcaacggagggacagtgaccaaagtgtggaacaag
aagaggaaatgcgttatggctcgaaagctcatcctagtagacgccaaaccgtccataaga
aagcagatccttcgagagttacaaatcatgaacgactgtgattctccatacatcgtcgga
tactatggatgttttcccgtcgacgtccatgtaggtatcgtcatggaattcatggatgct
ggatctctggactacatctataggcatcacggcgccattgacattgacatcgttggtaaa
gtcgctcaagcagtgctggagggtctgatttacctttatgataaacaccgcatcatacat
cgagatatcaagccgtccaatgtattagccaacactcgaggggagataaagatatgtgat
tttggagtctctggcgagttgattaactcgatcgccaatacctttgtgggcaccagcaca
tatatgagcccggagcggattcagggagcgccgtacacgatcaaatcagacatctggtct
ctcggtatctcccttatcgagttggctgttggccgtttcccattctccgattcacccgac
tcggaagaactctcacctagcgtttccgactttgatcctgatcctacacttcctcggtcc
gttcgacgccctaaaattgaatcaaacagcagacataacggcgtcagtcagagtggtgga
ccgcacgccatgtctattcttgacctgttgcaacatatcgtcaatgagccagccccaagg
ttggcaagcagacggaggagattccctcaggaggcggttgcatttgtggagggctgcttg
atcaaggatcccgatcaacgaaggagtcctaaagagctgctgtcttcttcgtggataacc
aacctcaaaaccaccaaagaggaccttcaaacctgggctcaatccatgattatatttcgg
cttcgcatattttttaatgttgatactcttctttgtatatctctaatcaccatctcgcat
atccccgtccatcatatgccctgtgtatacttattactcatgacaatatcatctgcagac
gaagaaatgatgcatgtttggcttatgtaa

DBGET integrated database retrieval system