KEGG   Cryptococcus neoformans JEC21: CNC03200Help
Entry
CNC03200          CDS       T00243                                 

Definition
(RefSeq) cap binding protein
  KO
K03259  
translation initiation factor 4E
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNC03200
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CNC03200
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNC03200
Translation factors [BR:cne03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CNC03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(1011549..1011767,1011824..1012048,1012096..1012212,1012270..1012385,1012447..1012669)
Genome map
AA seq 299 aa AA seqDB search
MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQLEEGEIEENPSEGDSQT
KTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAMPQGSHGWMADIRKVVSFD
SVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQNKNGGKWSIQVPKNSESKSSI
DRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGVIVSPRPAFYRISIWTREASDVN
VLDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGFQTELTFDAHKDSEKKVNKNKFTV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaacagccataccccctgcagcggttgcggccaacaacaacactctcaatagc
gccctcgccgctgaacaaatttcaagtcccgcttcaccagtcgacaagcccgtggatgaa
aagaaacagcttgaagaaggcgagattgaagagaatccttcagaaggcgactcccaaaca
aagaccatttttgacgatgccagtaaattcaatgttaagcacccattgttttccacttgg
actctttacttcgattcccctcaatcaaagtctctccctaaaaccccgcagactaccccc
gctatgccccagggatcccatggctggatggcggatatccgaaaggtcgtgtcgttcgac
agtgtggaagagttctggggtctctataacaacatcattcctccctcccagctccctggt
aaagccaactattatcttttcaaaaatggcattattccggcctgggaagaccctcaaaac
aagaatggtggaaaatggtctattcaagtacccaagaacagcgaaagcaaaagttccatt
gacagaatgtggctctatacgatgcttgctgcgattggcgaaactttcgagacagcctcc
accgactctgagaatgccccttcccctacccaatcagatctcatcaccggcgtgatcgtc
tctcctcgtcccgctttctatcgaatttccatttggactcgcgaggccagcgatgttaac
gttctcgacactgatgcgatcaaggctcgtctgctcaacatcggcaaacacttcaagaca
agtgtcttagggtacgaacttgagcagaagctcacagaggggggcttccaaacagagctc
actttcgatgctcacaaagattctgaaaagaaagtgaacaagaacaaattcactgtgtaa

DBGET integrated database retrieval system