KEGG   Cryptococcus neoformans JEC21: CNC03200Help
Entry
CNC03200          CDS       T00243                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cne03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(1011549..1011767,1011824..1012048,1012096..1012212,1012270..1012385,1012447..1012669)
Genome map
AA seq 299 aa AA seqDB search
MTSTAIPPAAVAANNNTLNSALAAEQISSPASPVDKPVDEKKQLEEGEIEENPSEGDSQT
KTIFDDASKFNVKHPLFSTWTLYFDSPQSKSLPKTPQTTPAMPQGSHGWMADIRKVVSFD
SVEEFWGLYNNIIPPSQLPGKANYYLFKNGIIPAWEDPQNKNGGKWSIQVPKNSESKSSI
DRMWLYTMLAAIGETFETASTDSENAPSPTQSDLITGVIVSPRPAFYRISIWTREASDVN
VLDTDAIKARLLNIGKHFKTSVLGYELEQKLTEGGFQTELTFDAHKDSEKKVNKNKFTV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaacagccataccccctgcagcggttgcggccaacaacaacactctcaatagc
gccctcgccgctgaacaaatttcaagtcccgcttcaccagtcgacaagcccgtggatgaa
aagaaacagcttgaagaaggcgagattgaagagaatccttcagaaggcgactcccaaaca
aagaccatttttgacgatgccagtaaattcaatgttaagcacccattgttttccacttgg
actctttacttcgattcccctcaatcaaagtctctccctaaaaccccgcagactaccccc
gctatgccccagggatcccatggctggatggcggatatccgaaaggtcgtgtcgttcgac
agtgtggaagagttctggggtctctataacaacatcattcctccctcccagctccctggt
aaagccaactattatcttttcaaaaatggcattattccggcctgggaagaccctcaaaac
aagaatggtggaaaatggtctattcaagtacccaagaacagcgaaagcaaaagttccatt
gacagaatgtggctctatacgatgcttgctgcgattggcgaaactttcgagacagcctcc
accgactctgagaatgccccttcccctacccaatcagatctcatcaccggcgtgatcgtc
tctcctcgtcccgctttctatcgaatttccatttggactcgcgaggccagcgatgttaac
gttctcgacactgatgcgatcaaggctcgtctgctcaacatcggcaaacacttcaagaca
agtgtcttagggtacgaacttgagcagaagctcacagaggggggcttccaaacagagctc
actttcgatgctcacaaagattctgaaaagaaagtgaacaagaacaaattcactgtgtaa

DBGET integrated database retrieval system