KEGG   Cryptococcus neoformans JEC21: CNC03920Help
Entry
CNC03920          CDS       T00243                                 

Definition
DNA supercoiling
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CNC03920
Enzymes [BR:cne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CNC03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(1212230..1212567,1212615..1212640,1212715..1212787,1212837..1212938,1212987..1213391,1213440..1213518,1213570..1213687,1213738..1213768,1213835..1213903,1213952..1213986,1214405..1214589,1214641..1214713,1214760..1214879,1214922..1214956,1215011..1215399,1215450..1215482,1215539..1215580,1215637..1215785,1215847..1215912,1215961..1216130,1216196..1216216,1216272..1216694)
Genome map
AA seq 993 aa AA seqDB search
MTIGTIKPRRSLGAIIDSIPSQQEYVPDSCSENSGSDSERDAPIPTLKPIPLTPLPPRSA
RLISELGADPIKIGKKNEREEARAVPGDGKIDTKVHGAVDTLLAPVLYFAVQWRKPQFKK
HKTWDGDANIKVEGNRIVMLDEDGNQMAATNVGDKVIKPEAEFKIGGYEIMVDHVLQQDQ
FKASTSILNRPKVIPTIKSTGYRPASFTKPFRPPIQKANLTPAKPSTMEIVNNEQHQSPI
SSSSKRSIPTPAAAQRAVAASSFYTRQSPKPFNERIVLGEKSNKERLQWGGALFNPHAEG
AVVMPRPGEKLAKLKGTTIVDVVLDPVLGNLLRDHQKEGVKFMYSCVMGMTGAEGEGCIL
ADEMGLGKTLQTIALIYTMLKQSPFANQTSIIGKAIIVCPVTLVDNWRKEFKKWVDRRVN
VLVADVLSGTPVQNDLGEYWAMVNFACPGVLGKYSAFAKHYEKPILKSRTPNCSAKDVEL
GRERANDLAKLSKEFVLRRTAAVLENYLPPKYEYVIFIAPSLLQLSVLSNLLDPNIVGSF
IRGYGAQSLALIDLMRKISNSPMLLKRRDDELARANDDLGSATSAAISAIPSDANINDVT
TSGKMLMLDKMLHSIYQCTEEKVVVVSNWTSTLDLIQGLCKLKRYNYLRLDGSTPPKQRQ
ELVDRFNKDKGRQESFVFLLSAKAGGVGLNLIGGSRLILFDSDWNPSTDLQAMARIHRDG
QKRPVYIYRFLTTNAIDEKIYQRQITKTGLSDQMMDQTRTEKQTSKDSFSAAELRDIFTL
NVRTDGCQTHDLLGCQCTRKPVGETRDIAEGEHNSKDLPDNASEESDNDENDHPTFVSAN
KYDPEPTPKMRRKAIQEQKNKLAALKHWAHFDPFEPASFRGIQDSLLYNVLFDSWETDSA
PLSQNIKTYGSLAFESPHERHEDDLDSDEEVLVPKKRKSGIVRSGVMLKKARAADEENTG
FSQRRHNLRSIAESGGTGRVTFVFEKISKSTIA
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcggaacgatcaagcccaggcgcagtctcggtgccatcatagactctattcct
agccaacaggaatatgttccagattcttgctcggaaaactcaggctccgattcagaacga
gatgctcccattccaactctcaaacccataccactcacgcctttacctcccagatcagca
cgcttgattagcgaactaggggccgaccccataaaaatagggaagaagaacgaaagagag
gaggctagagctgtacctggtgacggcaaaatagatacgaaggtccatggggctgtcgac
actttattagcgccggtattgtattttgccgtgcagtggaggaaaccccaatttaagaag
cataaaacttgggatggggatgccaacatcaaggtagaaggtaacaggattgtaatgctt
gacgaggatggaaatcaaatggccgctaccaatgttggggataaggtgatcaagccagaa
gccgaatttaagatcggtggatatgagatcatggtagatcatgtattgcaacaggaccaa
ttcaaagctagtaccagtattctcaacagacctaaagttatcccaacaatcaaaagcacc
ggctaccgacctgcatcattcacaaagccctttagacctcccatacagaaagcaaatttg
accccagcaaagccatcaactatggaaattgtcaacaatgaacaacaccagtcgcccatt
tcctcatcttcaaagcgctccatcccaacacccgcagccgcccaacgagcagttgctgct
tcatcattttatacgagacaatcacctaaaccattcaatgaaaggattgtattgggagag
aagagcaacaaggagaggctacaatgggggggagcgttattcaaccctcatgctgaaggt
gcagtggtgatgcccaggcctggggaaaagctggctaaattgaaaggcacaaccatcgtg
gatgtggtgcttgaccccgtcttggggaacttattgcgggaccatcagaaagaaggtgtc
aaatttatgtactcgtgtgtcatggggatgaccggtgcggaaggcgaaggatgcatcctt
gcggatgagatgggtttgggcaagacgcttcaaacaatagcactcatttacaccatgctg
aagcagtctccctttgccaatcaaacatccattatcggcaaagcgatcattgtgtgtccg
gtaacgttggtggacaattggcgcaaagagttcaagaaatgggtggataggcgagtgaac
gttctggtggccgatgtcttatcagggacgccagtacagaacgatctaggtgaatattgg
gcgatggtcaattttgcttgtccgggtgtgttgggaaaatactcggctttcgcaaagcat
tatgaaaagccaatattaaaaagcagaacacctaactgttcagcgaaagatgtagagcta
ggcagggaaagagcaaatgatttagccaagttgtccaaggagtttgtcctgcgaaggacg
gctgcagtgcttgaaaattatttgcctcccaagtacgagtacgtaatttttatcgcccca
tcccttcttcagctttcggtcctttcaaacctcctcgaccctaatatcgtcggaagcttc
atccgaggctatggtgcgcagtcattagctctaattgatctcatgaggaaaatttccaat
tctcctatgcttttaaaacgaagagacgacgaattagcacgagcaaatgatgatttaggc
tcagccacctcagcagcaatctctgctatccctagcgatgccaacatcaacgatgtgact
acgtctggcaagatgctcatgcttgacaaaatgctccattccatctaccaatgcactgaa
gaaaaagttgttgttgtgtctaactggacttctacacttgacttgatccaaggattatgt
aaactgaagaggtacaattatctcagacttgatggtagtactccgccgaagcagagacaa
gagctagttgataggttcaacaaagacaagggaagacaagaaagttttgtttttctgctt
agtgccaaagctggcggagtgggactcaacctgattggtggatcgaggttgattttgttc
gacagcgattggaacccctccaccgacctccaagctatggcccggatacatcgcgacggg
caaaagcgcccagtctatatctatcgctttctcactactaacgccatcgatgagaaaatc
tatcaacgtcaaattactaagacggggctatcagaccagatgatggatcaaacgcgtaca
gagaaacagacgagcaaagattctttctcggcagcagaattgagggacatattcaccctg
aatgtacgaacggacggttgtcaaacacatgatttgttgggttgtcagtgcacgagaaaa
cctgtaggcgaaacgagggacattgcggaaggggagcataattcaaaggacctgccagac
aatgcgtctgaggaaagtgataatgacgaaaacgatcatcccacttttgtcagtgccaat
aaatatgatcccgaacccactcccaaaatgcgtcgcaaggccattcaagagcaaaaaaac
aaactcgccgcgctgaagcactgggcacatttcgatccttttgaacctgcatcattccgt
ggcatacaagactctcttctgtataacgtactgttcgattcgtgggagactgatagtgcc
cctttatcccaaaacatcaaaacatatggctctctggccttcgagagcccccatgaaagg
catgaggatgatcttgactcagatgaagaagttttggtacccaaaaaacgcaaatctggg
atagtaagaagtggagtcatgctgaagaaagcgagggcagcggacgaggagaatacgggg
ttcagccaaagaaggcataatctgagaagcatcgcggaaagtggaggaactgggagagtg
acatttgtgtttgagaagatatcaaaaagtaccatagcctaa

DBGET integrated database retrieval system