KEGG   Cryptococcus neoformans JEC21: CNC04820Help
Entry
CNC04820          CDS       T00243                                 

Definition
phosphoinositide phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cne00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cne04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(1460102..1460314,1460382..1460778,1460829..1461115,1461177..1462094)
Genome map
AA seq 604 aa AA seqDB search
MIALTDEIYFLWVKTLKQLVSITLDRQVTDITPSDPDMLWIRQLWPLGTKAINREKAEAL
CAQIGLQIKADGMLDITVFHDLIKASQTRPDINQVYRDLTLSGLLDKGRVVSFLTHIQRI
PSSSVENVFNRYKSGDLWTIDSLTSFLSSSDNTPNQPQDMTHPLQHYFISSSHNTYLVGE
QWKGESTVEGYIRVLLAGCRCVEMDVQSGDVEPVVYHRKTLTSSVPVRDICRAIKQYGFV
TSPYPIIISTEIHCASEQQNRLAIILKEVFGDMLVSAPLVEEFSELPSPEDLKGKILFKA
KPPKPELNSPKLEANLFYQESPSSTDSDTSFVRLARRLSIQSKTERPDIFSPQLSELLVY
THGVKYQGFSKLNEYLPSHQFSVSERTAAKILKENKVDWIKHNFKHISRVYPRGTRLGST
NFNPVDSWSAGCQIVALNWQTLDESILLNHAMFHDSNGYILKPLSLREKVVEVPEKYLLT
VRIISGQRTPLCADLYVEAILNGKISKRTRALSQVTLNPLWDETLTFEITSTPSLLMLNF
LHLEVRNKALQAQWMRPVSLAPRGYHHLPLYDSLLSRFVFATLFVKITVEKLQDVVENEK
SNLI
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccttaccgacgagatatatttcctttgggtcaagacgttgaagcaactggta
tctatcactttggatcgccaggttaccgacatcacgccgtctgacccagatatgctctgg
attagacagttatggcctctaggtaccaaagctattaatcgtgaaaaagccgaggcccta
tgcgctcagatcggattgcaaattaaagccgatggcatgctagacatcacagtctttcat
gaccttattaaagctagccagactcgacctgacatcaatcaggtttatcgcgacctcact
ctgagcggtcttctcgataagggacgcgttgtctcttttcttacacatatacagcgtatt
ccatcttcctctgtcgagaatgtgttcaacagatataagtctggagacttgtggaccata
gactctctgacttccttcttatcctcgtctgacaacactcctaatcaaccccaggatatg
acacatcctcttcaacattatttcatttcgagttcccacaatacgtatcttgtgggagag
caatggaaaggtgagagcaccgtggagggttacatccgtgtgttgttagcaggttgtcga
tgtgtagagatggatgtgcaatctggtgatgttgaacctgtcgtgtaccatcgcaaaact
ttgacatcaagtgtcccagtccgagacatctgccgtgccattaagcagtacggctttgta
acatcgccttatcctatcattatctccactgagatccactgcgcctcagagcagcaaaac
cgattggcaatcatattaaaggaagtttttggtgatatgctggtttccgctcctctggtc
gaggaattttcggagttacctagtcctgaagacctgaagggcaaaatccttttcaaggct
aaacctcccaaacccgaactgaattcaccaaaactcgaagccaaccttttctatcaagaa
tcaccgtcttctactgattccgatactagcttcgttcgtcttgctcgccgcctttcaata
caatccaaaactgaacgtccggatatcttctccccccagctctcagaacttctcgtctat
acccatggtgtaaagtaccaaggcttttctaagctcaacgaatatctacctagtcaccag
ttttcagtctctgagcgaacagctgccaagatcttgaaagaaaacaaggtagactggata
aagcacaatttcaaacatatctcaagggtttatccacggggtaccagacttggttcgaca
aattttaatcctgtcgattcttggtctgcaggctgtcaaattgtggccttaaattggcaa
accttggatgaatcaatattgctgaatcacgccatgtttcacgacagtaatgggtacatc
cttaaaccgctttctctacgtgagaaggtcgttgaggtgcctgaaaaataccttcttacg
gtacgaatcatctctgggcaacgcacaccactttgtgccgatctttatgtcgaagcaatc
cttaacgggaaaatctcaaagcgcactcgcgcacttagtcaagtcactctcaacccttta
tgggatgaaactttgacatttgaaatcaccagcacaccaagtttattgatgctcaacttt
ctgcatttagaagtcagaaataaagctttgcaagcgcagtggatgaggccagtcagtcta
gcaccccgaggctatcaccacttgccattgtacgatagccttttgtcacgattcgtcttc
gcgaccttatttgtgaaaataacggtagagaaattgcaagatgtagtcgaaaacgagaaa
tcaaatttgatttaa

DBGET integrated database retrieval system