KEGG   Cryptococcus neoformans JEC21: CNC05350Help
Entry
CNC05350          CDS       T00243                                 

Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CNC05350
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CNC05350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(join(1599960..1600417,1600467..1600614,1600659..1600751,1600803..1601135,1601182..1601316))
Genome map
AA seq 388 aa AA seqDB search
MKIAWSAVITAALLPFSAYAGMYGQPVLHLDSKTFKSVMASEHAAMVAFVAPWCGHCKNL
GPEYTAAAQSLSPLIPFYAVDCDDASNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGER
KRGALVEYAKGLVPERVKKLRVQGDIQSDVQGFLGEKSELPHVLLVHPSSPSIPFLWKVL
AHRFSNKLHLGYVRDTTSHEVLSSLGIYDSADTTRDGTRVVAWSPGSQSGEFVEYDGILK
FNALLEWLQTTFPSAAPSNAKQRPVKAPQPTVKSTNKRQEQIPTQSQNDAAARRAKLEEM
ERRDKARREKAAEAARAQTMATEAEPEIEKEATPVEDAANAAPAQMVEDTSLPAEEMESR
PVPEEAPEDEGSAGDVEVEKTEVVHEEL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcctggtctgcagtaataacagctgcgctgttgccgttctctgcctatgca
ggcatgtatggccagcctgttctccatctcgactccaagacattcaagtccgtcatggcc
agtgaacatgcggcgatggtcgcctttgtggcaccgtggtgtgggcactgtaaaaatctc
ggacccgaatacactgctgcggcccaatcactttcgcctctgatcccattctatgctgtt
gactgtgacgatgcgtccaatcgtgggctttgcgctgaatatggtgttcaaggatatcca
actataaaaggtttccccaaggcggggaagggagctgctaaggaatacaatggtgaaagg
aagaggggtgcgctagtggaatacgcgaaggggttggtgcccgagagggtcaagaagtta
agagttcagggagacattcagtctgatgtgcaaggttttttgggggagaaatctgagctt
ccgcatgtccttcttgtccacccctcgtcgccttctattcctttcctatggaaagttctc
gctcaccgtttctccaacaagctccacctcggatacgtacgagatactacatcacatgaa
gttctttcatcgctcggcatttacgactccgcagacactactcgtgacggtacacgagtc
gtcgcttggtctcccggctctcaaagcggggagtttgtagaatatgatggtatccttaaa
ttcaatgcccttctggaatggctccaaaccactttcccttcagccgctccttccaacgcc
aagcaaagacctgtcaaagctcctcaaccgaccgtcaaatcgaccaacaagaggcaggag
cagattcctacccaatcccaaaatgatgccgctgccaggagagccaagttggaagaaatg
gaaaggagggacaaggcgagaagagagaaggccgctgaagctgcaagggctcaaacgatg
gccactgaggcagaacccgagatagaaaaggaggctactcctgtggaggacgcggcgaat
gcggcccctgctcaaatggtagaagatacctctttaccagcggaagaaatggaatcaaga
cctgtgcccgaggaagcgcctgaggatgaagggtcagcgggcgatgtggaggttgagaaa
actgaagtggttcatgaggaactataa

DBGET integrated database retrieval system