KEGG   Cryptococcus neoformans JEC21: CNC06590Help
Entry
CNC06590          CDS       T00243                                 

Definition
mitogen-activated protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CNC06590
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNC06590
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CNC06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:join(1927684..1927719,1927918..1927985,1928100..1928273,1928334..1928638,1928700..1929131,1929209..1929291)
Genome map
AA seq 365 aa AA seqDB search
MADFVKLSIFGTVFEVTTRYVDLQPVGMGAFGLVCSAKDQLSGTSVAIKKIMKPFSTPVL
SKRTYRELKLLKHLRHENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQILRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVAVDIWSTGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIQT
IASENTLRFVQSLPKREKVPFSTKFPNADPVSLDLLEKMLVFDPRTRISAAEGLAHEYLA
PYHDPTDEPVAAEVFDWSFNDADLPVDTWKVMMYSEILDFHNLGDISQNEAEGPVTGEVP
AAPAS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccgattttgtcaagctctccatctttggaaccgtttttgaggttaccacgcgttat
gtcgacctccaacctgtcggtatgggcgctttcggtctcgtctgttccgccaaggatcag
ctctctggaacttctgtggctatcaagaagattatgaagccgttttcaaccccggttctt
tccaagaggacttaccgagagctcaagcttctcaaacacttgagacatgagaacattatc
tctcttagtgacattttcatctctcccctcgaagatatttactttgtcaccgagctgctc
ggtaccgaccttcatcgactccttacctctcgccctcttgagaagcaattcatccaatac
ttcctttaccaaatcctccgtggcctcaagtatgtccactctgccggtgtagtccatcga
gacttgaagccttcaaacattctcgtcaacgagaactgtgacttaaaaatttgcgatttt
ggccttgcgaggatccaagaccctcagatgactggttatgtttctacgaggtactatcga
gcacccgagatcatgttgacatggcaaaagtatgatgtcgcggtcgacatttggagtacc
ggctgtatctttgcggagatgctggagggcaagccattattccccggaaaggaccacgtg
aaccaattctcaatcatcaccgaattgctcggtaccccgccggacgatgtcattcaaact
atcgcctctgaaaacactctccgcttcgtccagagtctgcccaagcgcgaaaaggtccca
ttttccaccaagttccccaatgccgaccctgtttctcttgatttgttagagaagatgctc
gtgtttgaccctcgtacccgtatatccgccgcggaaggtcttgcgcacgagtaccttgca
ccttaccatgatcctaccgatgagcctgttgccgcagaggtgtttgattggagttttaac
gatgccgatttgccggtggatacttggaaggtgatgatgtacagcgaaattcttgacttc
cacaacctcggggacatttcccagaacgaagcagagggacccgttacaggcgaagtcccc
gctgctcctgccagctaa

DBGET integrated database retrieval system