KEGG   Cryptococcus neoformans JEC21: CND00260Help
Entry
CND00260          CDS       T00243                                 

Definition
calcium-dependent protein serine/threonine phosphatase
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cne  Cryptococcus neoformans JEC21
Brite
Protein phosphatases and associated proteins [BR:cne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CND00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(80833..80860,80926..80985,81039..81094,81149..81243,81303..81388,81445..81595,81686..81737))
Genome map
AA seq 175 aa AA seqDB search
MGAAESSMFNSLEKNSNFSGPELMRLKKRFMKLDKDGSGSIDKDEFLQIPQIANNPLAHR
MIAIFDEDGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVYDMDRDGYISNGELYLVLK
QMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMVASTDIVKQMTLEDLF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgctgaatcctccatgttcaactctctggagaagaactccaacttctcagga
ccggagcttatgaggttgaagaagaggttcatgaagcttgacaaggacggttccggatcg
attgacaaagacgagtttcttcagatccctcaaatcgcgaataaccctttggcgcatcga
atgatagcaatctttgatgaagatggaagtggaacggttgacttccaagaatttgtcgga
ggtttgagcgctttcagtagtaaaggaggtcgtgatgagaagctgagattcgctttcaag
gtgtacgacatggatcgagacggctacatctctaacggtgaactgtatcttgtgttgaag
caaatggtcggaaataaccttaaagaccaacaattgcaacaaattgtagacaaaaccatc
atggaggctgacaaggacggggatggaaagctctcttttgaggagttcacacaaatggtc
gccagcacagatattgtgaagcaaatgacccttgaagatcttttctaa

DBGET integrated database retrieval system