KEGG   Cryptococcus neoformans JEC21: CND01170Help
Entry
CND01170          CDS       T00243                                 

Definition
ubiquitin-specific protease
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CND01170
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CND01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:join(339765..339860,339913..340074,340124..340165,340220..340276,340322..340371,340424..340697,340751..340976,341030..341106)
Genome map
AA seq 327 aa AA seqDB search
MADDPSGWSLTESDPQVFTQLLKDLGVNGLQVDDLYSLDAETLATLKPIHALIFLFKYVA
PDAESAQESAGVEVDPLDNGVWFANQVINNSCGTLAALNAVMNIKPQQSVHERESIKLGS
ELENLREFGAGMQSLDLGHVLSSSDHIREVHNSFSKSSPFAMDPSAFPEREKEDAYHFVA
YLPINDILYELDGLRRFPIMHAPVDGDWLDTARETIEQRIATYPPGSLMFNLLCVRSDAI
PRLERLLNDPSTPAEQKFVIQDQLEHERNKSQKGAMENSLRRHNLLPVVFQLFKSLGESG
MAAKAVEDARTKGKERRERMQAKGEAE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgacccttcaggctggtcgctcacagagtcagacccccaggtattcacccag
ctgctaaaggacttgggcgtaaacggattgcaagtagacgacctgtactctctcgatgct
gaaacgcttgctaccctaaaacctattcacgccctcatcttcctcttcaaatacgtcgca
ccggatgcggagtctgcccaagaaagtgccggtgtagaggttgatcctttagataatggc
gtatggtttgccaatcaggttatcaacaacagttgcgggactcttgcggctcttaatgct
gtcatgaacatcaagcctcagcaatcggttcacgaacgtgaatccattaaacttgggagc
gaacttgaaaacctccgagagtttggtgcgggcatgcaatctctcgatctcggccacgtc
ctttcttcgtccgaccacatccgcgaggtccacaactcattctccaaatcgtctccgttt
gctatggacccttcagccttcccagaaagagaaaaggaggatgcctatcatttcgtcgcg
tacttgcccatcaatgatatcttgtacgagctggacggcttgagaaggtttcccatcatg
cacgctcctgttgacggtgactggctcgataccgctagggaaacgattgaacagaggatt
gcaacttatccccctggatctctcatgttcaaccttctctgtgtccgatctgacgccatt
ccccgccttgagcgactcctcaatgatccctcaacccccgctgagcaaaagtttgttatt
caagatcagcttgaacacgaacgcaacaagtcccaaaagggcgccatggaaaattctttg
agaagacacaacttgcttcctgtcgtttttcagttgttcaagtcgttgggcgaaagtggt
atggccgcaaaggctgtcgaagacgctcgaacgaagggcaaagaaaggcgagagagaatg
caagccaagggcgaggccgagtaa

DBGET integrated database retrieval system