KEGG   Cryptococcus neoformans JEC21: CND02630Help
Entry
CND02630          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(714845..714935,714990..715073,715142..715195,715252..715351,715402..715463,715518..715747,715798..715937,716001..716253,716307..716426))
Genome map
AA seq 377 aa AA seqDB search
MSFRAPNLIRSAAGRRASQTLNLRSQVIRRRFATEGGPEITKPSSPRSSNTRYLLAGVGI
AAVGAAYYFYGTGRTAHDSANKADTVVRGAVATVEAKTGLRRGKDEYQKVYNRIAETLEK
EGYDDGSLAPVLLRLAWHSSGTYNKEDGTGGSNFATMRFKPEAEHSANNGLHVAREHMEK
IKQEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRIDGFEAQVTPDGRLPDASQAQDHL
RFIFNRMGFNDQEIVALSGAHAMGRCHTNRSGFEGPWTFSPVTFSNQYFALLRDEPWQWK
KWTGPAQYEDKNTKTLMMLPTDMALLKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELG
VPERQWAGEPWTLGTSD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcagagctcccaatttgatacgatcagccgctggccgaagagccagtcaaact
ttgaacctgcgttctcaagttattcgacgacgatttgcaactgagggtggaccggagatt
accaaaccatcttctccacgatcttcgaacactcgttatctcctcgcaggtgtcggtatc
gctgccgtcggcgctgcatactatttctacggcactggcagaaccgcgcacgattccgcc
aataaagctgacacggtagtgcgtggagctgttgccacggttgaggccaagacgggtctc
cgaagaggcaaggacgagtatcaaaaagtctataatcggattgccgagactctcgagaag
gagggttacgacgacggttctttggcccccgtccttcttcgcttggcttggcactcctct
ggcacctataacaaagaggatggtactggaggatcgaactttgctaccatgaggttcaag
cccgaggccgagcacagcgcgaacaatggcctacatgttgccagggaacatatggaaaag
atcaagcaagagttcccctggatctcttacggtgacctatggaccctcggtggagtctgt
gctgtccaggagtcgggcggacctaccatcccttggaggcctggcagaattgacggcttc
gaagctcaagtcactcccgatggtaggctaccggatgcctctcaagcccaagaccatctg
aggttcatctttaaccgcatgggcttcaatgaccaagaaattgttgcccttagcggcgct
catgccatggggcgatgtcatactaatcgatcgggctttgagggcccttggactttctcc
cctgtcaccttttccaaccagtactttgctcttctccgagacgagccttggcagtggaag
aagtggaccggacctgcccaatatgaagacaaaaacacaaagaccttgatgatgcttcct
acggatatggcgctcctcaaagacaagtccttcaagaagtatgttgacatctatgccgat
aacgaagagaaattctttagcgacttcgcgaaagcattctccaagctcattgagcttggt
gtccctgagaggcaatgggctggtgaaccttggactttgggaaccagcgattaa

DBGET integrated database retrieval system