KEGG   Cryptococcus neoformans JEC21: CND02800Help
Entry
CND02800          CDS       T00243                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CND02800
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CND02800
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CND02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(760214..760853,760906..761354,761416..761548,761603..761981,762036..762235,762308..762786))
Genome map
AA seq 759 aa AA seqDB search
MSRPIDLSMSSVKNPSPLAAGGTGGFTPVFEASPANSPAGSRRPSISQPTARRPSEVSIS
RRPSVNHQYSSYVSQYPQQGSLSRRSSMASGPRPIRRGEYSGPVTPSVLSRAGSPTLPLG
NEFTQAPRSYYEGASGYTPLGGTRELRNGQFIGSLDCGTTSTRFIIFDKRAKIIAEHQTE
FEQILPHAGWHEHDPDALVEAMNECIIKAVEKLEWMGWSRNSIKGIGITNQRETTVCWSR
STGKPLCNAIVWDDARTINVVREMEKKLDEEGLEIDDEEEDEINQKSKIVPDEVEMGTGT
HEAAFGEKGDVVDGDTSMTGKIGKAMEGLGLSGRGKDGKAKKYRKGKEGLVDVTGIPLST
YFSAIKLRWMLDHQKAVRIAHEADDLMFGTVDTWLVYNLTGANNGGLHIIDVTNASRTLL
ISLKTLRWHAPLLRFFGLRASILPKIVSSAEVYGNISDSLGLPLSGVPIAGIVGDQQAAL
VGNKCLMKGQAKCTYGTGAFVLFNTGEDIVRSNYGLISTVAFQAGADSKPVYALEGSIAV
AGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYFVTAFSGLLAPYWDREASGTIIGLT
GYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRLDTLKVDGGVTNSDLAMQLQANIGGF
NVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAGVHTFEPELEEKARLKKI
KGWNKAVDRAKKWHDIDDEDDEEEEYENEAGYAKIIGSA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccccatagacctttctatgtcctcggtcaagaacccctcgccccttgcggca
ggcggtaccggtggctttacccctgtcttcgaggcttctcctgccaattctcccgcaggt
tctcgtcgaccttctatctcacagcccacagctcgtcgcccttcagaagtctcgatttct
cgtaggccttctgtaaatcaccaatacagtagctacgtctcgcaatatcctcaacaaggg
tctctttcccgacgatcatctatggcttccggcccgcgacctatccggcggggcgaatat
tctggacctgtcacgccgtctgtcctatctcgagctggttcgcctaccttgcccctcggt
aacgaattcactcaagctccaaggtcatactatgagggtgcttcaggctacactcctttg
ggcggaacgcgggagttgcgtaatgggcaatttattggtagtctggattgtggtactacc
tctacgcgattcatcattttcgataagcgagcaaagattatcgcagagcatcaaaccgaa
ttcgaacagattctccctcatgcaggttggcatgagcatgaccccgacgcgctagttgaa
gcgatgaacgaatgtatcatcaaagctgttgaaaagctcgaatggatgggctggtccaga
aatagcatcaagggtattggtattaccaatcaacgagagacgactgtctgctggtcacgt
tctactggcaagcctctgtgtaatgctatcgtttgggatgatgcgcgaactatcaatgtg
gttcgtgagatggaaaagaagctcgacgaggagggcctggaaattgatgacgaggaggag
gacgagatcaatcaaaagtctaaaattgtgccagacgaagttgagatgggaactggtacg
catgaggcagccttcggggagaaaggtgatgtcgtagatggtgataccagtatgactggc
aaaattggaaaagcgatggagggtctcggcttgtcaggccgaggtaaagatggaaaggcg
aaaaagtacagaaagggcaaggaaggtctggtggacgttaccggtattcctctctctact
tacttttctgccatcaaacttcgatggatgttggatcatcaaaaggccgtccgaatcgcc
catgaagctgatgatctgatgttcggtactgttgatacttggcttgtctataatttgacc
ggtgccaacaatggcggtctccatattattgacgttaccaatgcctctcgaacactcctt
atctctcttaaaacacttcgatggcacgctcctctccttcgcttcttcggccttcgagct
tcgatccttccaaagatcgtgtcttcagccgaagtgtacggcaatatttctgattcactt
ggcctaccgctttccggtgttccaattgccggtattgttggtgaccaacaggccgcgctc
gtcggcaacaaatgtttgatgaagggccaggccaagtgcacttatggtaccggtgctttc
gtcttattcaacacgggcgaagacattgtgagaagcaactacggtctcatttctaccgta
gcctttcaagcaggtgcggacagtaagcctgtatatgcattggaaggttctattgccgtg
gctggatcggccataaaatggctacgagaccaaatgacccttattgaagaatctgccgaa
atggatatcctcgccggatcagtgtcggacactggaggtgtctattttgttaccgccttc
tctggccttcttgcgccgtattgggatcgtgaagcttctggcactatcattggtcttact
ggatacacaacttctgcccacattgcgcgggccacccttgaggctgtgtgtttccaaact
cgcgcggttttagatgtcatcgagaaagagagtggtagcaggctcgacacactcaaggtt
gatggtggtgtgaccaactcagacttggctatgcaattgcaggctaacatcggtggcttc
aacgttgcacgaccttcgatgcgcgagtctactgcgcttggttccgctttgctggccgct
catgctcttggtctgtttggttgggatctgacccgtccagaaactctcagtgaggtgaac
accgctggtgtccatacattcgagcccgagttggaggagaaagccagactgaagaagatc
aagggatggaataaggctgttgatagggccaagaaatggcatgacatcgacgatgaggac
gacgaagaagaagaatacgaaaacgaagccggatacgctaagatcatcgggtcggcttaa

DBGET integrated database retrieval system