KEGG   Cryptococcus neoformans JEC21: CND03500Help
Entry
CND03500          CDS       T00243                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cne00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(949355..949476,949534..949656,949705..949879,949928..950143,950194..950385,950445..950521,950586..950618,950674..950932))
Genome map
AA seq 398 aa AA seqDB search
MYGRLGVSILLMAAASNVLAKIQEDDGYSEQLDPWNDEYANTPDLSFSGVASFAHLPHKR
CLDVKDAAFDIALLGVPFDSAVSFRPGARFGPYALRSGSRRQRPDRGYNSRLEVNPYSGD
LSILDCGDVPVTPFDPATAVKQINSAYRSLLHHPVVSPEKMQNLNMQRGLDGKIHPRIIT
LGGDHTIVLPILDAVHEVYGPVSVIHFDAHIDTWNPHRYVGSVSVQASLNHGTFFWHAYE
KGFIKPNSSIHAGIRTRFGGPQDLEDDVTAGFDLIHTFDLDDFGIDWISEKIKNRIGDGP
VVISLDVDVMDPAFVPATGTPESGGWTSRELRRILHSLIGLNIVALDIVELSPAYDTNAE
ISAIAAADMVYDFLSILALGVEHRNDGVSGTKTLKDEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggcggctcggtgtctccattcttctgatggcagctgcatcaaatgtactagcc
aaaattcaagaagacgacggttatagcgaacagctcgacccctggaacgacgaatatgcg
aacactccagacttgagcttcagtggagtagcaagttttgcccatctcccacataaaagg
tgcttggacgtcaaggatgcagcatttgatattgctctattgggtgtgccttttgactct
gctgtttcatttcggcctggcgcgaggtttggaccatacgctttgagaagtggctcacga
aggcagcggcctgaccgtggctacaacagcaggttagaagtcaacccatattcaggagat
ctctccatacttgattgtggtgacgttcctgtgacacctttcgatcctgcaactgcggta
aagcaaatcaactcagcatatcgatccttactccatcatcctgttgtatcaccagaaaag
atgcaaaacctaaacatgcagcgaggtctcgatggaaagatacacccccggatcatcact
ctgggcggcgatcataccattgttcttcctatcctcgatgccgttcatgaagtctacggg
ccagtctctgtcattcattttgatgctcatatcgacacatggaacccacacagatatgtt
ggcagtgtctcggtccaggctagccttaaccatgggactttcttttggcatgcgtacgag
aaaggtttcataaagcccaattcatccatccatgctggtataaggacccgctttgggggc
ccccaagatttggaagatgatgtgactgcaggatttgatcttatccatactttcgatttg
gatgactttgggattgactggatctcagagaagattaaaaacagaatcggtgatgggccg
gtcgtgattagccttgacgtcgatgtcatggatcctgcctttgtacctgctactggtacc
ccggagtccggtggatggacttctcgagagcttcgtaggatccttcactcacttattggg
ctcaatatcgtagccttggacattgtggaactttcgcctgcttatgataccaatgccgag
atatcggccattgccgcagcggacatggtgtacgactttttgtctatcctcgctctcggt
gtagagcatcgcaacgacggcgtcagtgggacaaagacattgaaggatgagctttga

DBGET integrated database retrieval system