KEGG   Cryptococcus neoformans JEC21: CND03610Help
Entry
CND03610          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CND03610
Enzymes [BR:cne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CND03610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(992361..992456,992532..992573,992635..992704,992797..994221,994303..994312,994344..995415,995470..997164))
Genome map
AA seq 1469 aa AA seqDB search
MAPHEKGVNPSESPSGSLKKAPPSGPKALRGFASPSAFRNADIGNGLLQHRGEDERISFA
FPRKGKESLDRNGERPAPMSLESRLGPPVSRFNRPVGGDSLERGNGKGGWDNRDERTSAS
SSSIHRINKEKIRPRSDFIESSANLYSEDDRNRDRGRYHERDRSRGTNGDRGGGEGHSHR
EPGRGKEHQNGQGRDRSLYRDHSRERESSRDERDRYSEEYKHQRSKARFSPSPSPERSRL
KSSLGRHRSPVSVSSSSSSSARSPPPVQNREPLRYNGSQSKNGEKELSNGLLENSISRSG
VSIAVPRKLETKQLVRPSPPHVNLKSTIQDNPSPPTGKYPPSPPSLDILSKPSCNREPLP
DQRPPTPPLPENSSPTSPSLESSRFDQNQHLLPDELPLPPLSISFPQKPVSSSSLSRLSS
LSAALSRPNPLDKDGTSMPPSFHFREISTRHQRLSPPNNAENQLPETSIIPPPPSETVPE
PPWIRPPYIPPPCTKHRPGIGNFFITNLREKVEDKSGKEEKRVDGMEGGKVVQVTDPRLS
MTEEQRGRGRGSSKQRAAFYELTYEWDLYSVTPKPPSPPTAVLITGLGPLTTVDQITKFL
RPHGRIKEIDSKVDRKTGMQLGICWVKFEGPPLGRPGTAHDVASMAVKVCDGKKISMGGE
RIRVVLDGRGKRAEQAVKEEMERRYPPKKPSALPSDMKVTPLSGTAMATTSRPPNAPNAS
TPLIDKQTFDTSAKAPIIRPGVLKPLGQKMYHRPSAPPLVFNNHRFRDESFLNRPFNAGA
GMISQQQMGYKILPGKPVQQLASSFTSAPFVRHPRERREDSWTNERGRRLKGESSTRHWR
ARSLSRSSYSSYSSYSSYSEESEEERPRHPTKVPYPQRKRLATGPSKEDEYKMEDVREAI
RENGHPCVFIDAKSLPAAREYESRQSHLGWYILFADDTTAYRVQRVLDTTAVQGHRLSLV
VHTSSGPRAQTDASEPVTGGVGESKKGNWRYLTITKKSRPMPAVKKSGKSATIRRKVYSP
SVSGSDDDDEQVPVMAQNRKRAPSYASSTSPLSEDDRPFARSVQREERDIDKEGKFSLIG
KKEDVVSVKAAKGPKSKTIRVDSDEVEENQGVPLASIGEVTKAEGKQDDSTVVKLETLLS
ESISELTKGKKRPTKAKGGKATKKVRLDQEADDAATKIQIDEDIVPQPPKKKKVVKTEVD
KLLASGVLMDEEDAYWLGRVLAAQEDGLEPIWSDGEEDLVDEGHPLFHKSGAWRAEGWKK
VAQVQKSRYLPQRNRAVVNSEDVGGITTGRTARLAGRDQHRQTAAVAANNTVESDLFAFN
QLRIRKKQLRFARSAIEGYGLYAMETIHAGEMVCEYVGDLVRATVADVREQRYLKQGIGS
SYLFRIDNDIVCDATFKGSVSRLINHSCDPSANAKIIKVNGQSKIVIYAERTLYPGEEIL
YDYKFPLESDPALRVPCLCGAATCRGWLN
NT seq 4410 nt NT seq  +upstreamnt  +downstreamnt
atggcacctcatgagaaaggtgtcaatccatcagagtcgccctccggcagcctcaaaaag
gcgccacctagtggccccaaagccctccgcggctttgcgtctccttccgcgttccgcaac
gctgatatcggcaatggcttactgcaacaccgtggcgaagatgagagaatctctttcgcg
tttcccaggaagggaaaggaaagcctcgacagaaacggagagcggccggcaccaatgagt
ttggagagcagattgggtccccctgtcagtcgcttcaaccgccctgtaggtggcgacagc
ttggagagaggtaatggaaaggggggctgggataatagggatgaaagaactagtgcaagt
tcttcctcaattcacagaataaataaggagaaaattcgccctcggtctgatttcatcgag
tctagtgcgaacctttattctgaagatgatcgcaatcgtgatcgaggcagatatcatgag
cgcgacaggtctagaggaacaaacggagataggggggggggagaaggtcacagtcatagg
gaacctggaagggggaaagagcatcagaatgggcaagggagagataggagcctttacaga
gaccattcaagagagagagagagctcgcgtgacgagcgcgacaggtacagcgaagagtac
aaacatcagcgtagcaaggccagattttccccaagtccaagtcctgaacgtagtagactt
aagtcatctttaggcaggcaccggtcaccagtttcggtctcatcgtcctcctcgtcctcc
gcccgctcgcctccacccgtgcagaatcgagaacctttaagatataatggctctcaatct
aaaaatggggagaaagagctttcaaatggattgcttgagaactcaatttcccgatccggg
gtcagtatcgctgtgccgagaaagctggaaactaagcaattagttcgcccttcgccccct
catgtcaatctcaagtctaccatacaggataatccatctccaccaactggcaaatatccc
ccttcaccgccttctttagatatactttcgaaaccatcctgcaatcgtgaacctcttccg
gatcagcgtccacccaccccgccactaccggaaaattcatcgcccacatctccatccctt
gaatcgtcaaggtttgatcaaaatcaacacctcttacctgatgagttacctctaccgccc
ctctctatatcatttccccagaaaccagtctcatcatcatcattgtctcgtctctcttct
ctatccgccgctctgtcacgacctaaccctctcgacaaagacggtacttcgatgccgccg
tctttccacttcagagaaatatctactcgtcaccagagactttctcctccaaataatgcc
gaaaatcaattaccggaaacgtccattataccacctccaccgtctgagactgtaccagaa
cccccgtggattcgtcccccatacatcccccctccttgcaccaagcatcgtccgggaata
ggcaacttttttatcaccaatcttagagaaaaagtggaagataaatcagggaaagaagag
aagagggttgatgggatggaaggcggaaaagttgtgcaggtgacagatccgagactgtca
atgacggaggaacagcgagggaggggaagagggagctcaaagcaaagagcggcgttttac
gagttgacttacgagtgggatttgtattccgttactcccaaacctccttcaccaccgacg
gctgtcttgatcacaggccttggtcctctgactacggttgaccagattaccaaatttttg
cgaccccatggccgcatcaaagagattgactctaaagttgaccggaaaacaggcatgcag
cttggaatatgttgggtcaagttcgagggaccccctttgggtcgtcctggtaccgcgcac
gatgtagcaagtatggccgtcaaggtgtgtgatggaaagaagataagcatgggaggcgag
cgaatcagagtggtgttggacggcagggggaagagagcagaacaggcggtgaaagaagag
atggaaaggaggtatcctcctaagaagccttctgcgttgccaagcgacatgaaggtgaca
cccctgtccgggacagcaatggctacgacgtccagacctccaaatgctccaaatgcaagc
actcctttgatcgataagcagacatttgatacgtctgccaaagctccgattattagacct
ggcgtactgaagcctttaggacagaagatgtatcatcgcccatcagctcctcccctcgtc
ttcaacaatcaccgattccgcgatgaatcattccttaatagaccattcaatgccggtgca
ggaatgatatcgcagcagcaaatgggatataagatactaccagggaaaccagtgcaacag
ttggcgtctagcttcacaagcgcgccattcgtcagacatccacgggaaaggagagaagac
agttggaccaatgaacgcggcaggcgattgaaaggagaatcatctacccgccattggcgc
gcgagatcgctgtcacgatcttcttattcttcctactcttcatactcttcctattctgaa
gagagtgaggaagagcgaccccggcatcccacgaaagtaccatatcctcagaggaaacgc
cttgccacaggaccgagcaaagaggacgagtataaaatggaagatgttagggaagcaatc
agggagaatggtcacccatgcgtatttattgacgctaagtctctacccgctgcaagagag
tatgaaagccgacagagccatttgggctggtacattctttttgccgacgataccactgca
tatagggtccagcgcgtattggacaccacagcggtacaaggtcatcgcttatcgcttgtt
gtccatacatcttccggacctcgtgcgcaaacagacgcctcagaacctgtgaccggtggt
gtaggggaaagcaaaaagggcaactggcgatatttgacaatcacgaaaaagtctcgacca
atgcctgctgtgaagaagtcgggaaagtctgcgaccatcaggaggaaggtatactcacct
tcagtatctggtagcgacgacgatgatgagcaagtgcctgttatggctcagaacaggaaa
cgggctccatcatatgcaagctcgacctcgccactttcagaagatgacaggccgtttgcc
cgttcggtccaaagggaggaaagagatatcgacaaggaaggcaagttttctcttattgga
aaaaaggaagatgtagtatcagttaaggcggccaaaggtccaaagagtaaaacgatcaga
gtggactctgacgaagtggaagaaaatcaaggagtcccattggccagcattggggaagtc
acaaaggcggaaggaaagcaggatgatagtacggtcgtcaagctcgagacattactttct
gagagtatctctgagcttaccaaaggcaaaaagagacctaccaaagcgaagggagggaag
gctacaaagaaagtacgccttgaccaagaagccgacgatgcggctacgaaaatccaaatc
gacgaagatattgtacctcaaccacccaagaaaaagaaagtcgttaaaactgaggtcgat
aaacttttggcttccggtgtacttatggatgaagaagatgcgtactggcttggtcgagta
ttagccgcccaggaagatggcctcgagccgatttggtcggatggcgaagaagacttggtc
gatgaaggccaccctctctttcacaagtcaggggcttggcgagctgaagggtggaagaaa
gttgcccaagtgcaaaagtcaagatatcttccgcagcgcaaccgagctgtcgtcaactcc
gaggatgtcggagggatcactacaggcaggacggctcgtcttgctggccgtgatcagcac
cgacaaacagcagcagttgctgctaataataccgtcgaaagcgatctgtttgcattcaat
caattgcgtatcagaaagaagcagcttagattcgcgaggtcagcaattgaaggatatggg
ctgtatgcgatggagacgatccatgccggggaaatggtttgcgaatacgtgggtgattta
gtgcgggccaccgtggcggatgtgcgggagcagcgatatctaaaacaggggattggatca
tcgtatctctttagaattgataacgatatcgtttgtgacgccaccttcaaaggatcagta
agccggcttatcaaccattcatgcgatccgtcggccaacgccaaaatcattaaagtcaat
ggacaatcgaaaatcgttatatacgctgagcgaaccctttatcccggagaagagattctg
tatgattacaaatttccgctggaatctgatccagcactccgagtgccttgcctttgtggc
gccgcgacttgccgaggctggctcaactga

DBGET integrated database retrieval system