KEGG   Cryptococcus neoformans JEC21: CND04180Help
Entry
CND04180          CDS       T00243                                 

Definition
hydrolase
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CND04180
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CND04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:join(1162025..1162561,1162616..1163381,1163429..1164609,1164668..1164859,1164919..1164980,1165045..1165166,1165220..1165275,1165334..1165376,1165433..1165735,1165788..1165944,1166003..1166039,1166091..1166220,1166307..1166368,1166428..1166926,1167369..1167512,1167571..1167727,1167778..1167840,1167890..1168145)
Genome map
AA seq 1588 aa AA seqDB search
MLFYTFFKESSMGSAYLLLASRGKSREVCHLPTFTDIKDSCIVRMLQYSLTISLGFPHLL
ALFAGALLALFFLIRYRYLTRYAQLKESALPPPSPPALASRLLPLDGDGLGLPDSRSQTS
SFHNYLDDFLSAIRIFGYLEKPVFHELSRHLQTRRLAAGDTLEIGGGEFWCVVEGKVQVF
APDASSQGTPTPSSDTNSPTRPSFNGYHLLNEVSTGGTLSSLFSILSLFTEDIKLSWKSS
ADDEGEEEQIFEGAPEQSSAKLRVRRANSDVSQLGPDSIGVRAMDPTPLPESIDSHGDSS
VPQRRRERSSSIDAAGETVREREGIFASASLPISSTEPPSPRRSQSLRSSPRLNSATNLL
SSQSEHLRSSVPRKAGIEIGSKALKGTIARATEDTTLAVIPAAAFRKLTRKFPKASGTIV
QVVLERFSRVTFMTAHKYLGLTREILQTESSLNLLVTHPLPRSFYTGGGMQALRARFQPE
ALAKESVHYDSLKSSPNARVSSKDYFNYVPASPTVKAPSLPAMTPKPLSPIIHKSSLGQT
ATTTVKNEPLNGGSSPLDETRDKVPSFGLSTAAATNPDASFRHASPFIRRTSAMRQQVAA
GDLAMSVHNLPDESGQAYYRPTAITPGLSKMDTWQRRYSSSWNLNDSPHTDGQPVDPQRD
DESLLNESFDLKEAVLNSIAKSIGLYQEAESNSDMIARSSMAPSVSALSTPNSPMFPPNA
GTPLQGSTRSRPPHFGNVLDLINASSQNEGVIGGMLREAAFNSRPDDEASSISMSLHDSQ
GGASGVDRKIMKDLERHVEILFFKKGSVLVKEGERSPGMYYVIDGFLETSLPFRSTSSNQ
ENPNSTPGSKHRQSSFGSSNERPFKTALGLDTSKGKELDDGSKKDEALFTVKPGGIAGYL
SSLCCTDSYVDITAKTDCFVGFLPHHTLERIIERRPIVLLTLAKRLLSLLSPLVLHIDAA
LDWQQLNAGQVLYEKGDKSTDFYIVINGRLRAFTEKNDNMHVLREYGQNDSIGELDVITA
VDRSETVHAIRDSELVRIPAALFDAISIKHPETTVQFMRLIAGRVRRALGDEMNGRVPGL
PTTDMNLKTVCVLGSTRNVPVTQFAGKLKNALEEIGASTSYLDQGIVMRHLGRHAFARIG
KLKVAGWLADQEQHYRTVLYVADSPPASQWTLTCIRQADLVLVVSMGDDPSLGEYELILL
HDERTVAPGSTRQWLSNRPWIQTHYHVELPGVVTPARPIPPVHDAAAIAAFKHLREQVET
RIKKYRGLRPFTRPRRPPHMNDFARIARRLCGQQIGLVLGGGGARGISHIGMLQALEEFG
IPIDAIGGCSIGSFVGGLYARETDLLETAGRTKQFSGRMGSMWRILSDVTYPFVSYTTGH
EFNFWIPFFANSTNITHSRMEVHRTGYAWRYVRASMTLAGLLPPLSDNGNLLVDGGYMDN
TPIQPLRENGIRDIIVVDVGSVDDTSPRDYGDSVSGWWIFFNRFNPFYERRVLSMTEISS
RLTYVSSVKTLEGVKATPGCHYIAMPVQQFDTLGGFKRFSEVMEIGLKAGRETLKKWKEE
GKLPTGLVDEAKGSKAVQRGNRLRRMSI
NT seq 4767 nt NT seq  +upstreamnt  +downstreamnt
atgctattttatacgttcttcaaggagtcaagtatggggtcagcttacttactattggca
tcccgaggtaagagccgtgaggtctgccacttaccgacgttcactgacatcaaagatagc
tgcatcgtccgtatgctccaatatagcctgactatctcactcggttttccacatctcctt
gctttatttgccggcgcgcttctcgcactcttcttcctcataagatatcgctaccttacg
cgttatgctcagctaaaagagtcagctctaccacctccgtctccgcctgcactcgctagc
cgcctattacctttggatggggacgggctgggtttgccagattctaggtcgcaaacatca
tcatttcataactaccttgatgatttcctctccgctattagaatatttggctatttggaa
aaaccagtattccatgagttaagtagacatctgcaaactaggagacttgcggcaggggat
acattagaaatcggtggcggtgaattctggtgcgttgtggaaggcaaagtacaagtgttc
gcaccggatgcttcttcgcaaggaaccccgacaccctcttccgataccaacagccctaca
agaccctcattcaacggctatcatctccttaatgaagtatccacaggcgggactctctct
tctcttttctctatcctttccctattcactgaagatataaaactttcatggaaaagttct
gcagatgatgaaggcgaagaggagcagatttttgaaggtgctcctgaacagtcatcggca
aaattgagggtcagaagggcaaattcagatgtaagccaactggggccggactctattggg
gtccgtgcaatggatccaactcctctccctgaatcaatcgatagccatggagactcaagt
gttccccaacgtcgccgagaaagatcgtcttctatagatgctgctggagaaacggttcgc
gaaagagaaggcatttttgccagcgcttcgctgcctatttcaagtactgagcccccttct
ccccgacgctcccagtcgctccgttcttcacctcgtctgaattctgctacgaacttattg
tcctctcagtctgaacacctacgatcttcagtaccgaggaaagcgggtatagagatcgga
tcaaaagcgctgaaagggaccattgctcgggcgactgaggatacaacactcgccgtgatt
cctgccgctgcttttcgaaaattaactagaaaatttcccaaagccagcgggacaatcgtg
caagttgtcttggaaaggttcagccgtgttacattcatgacagcacacaaatatctcggt
ctgactcgcgaaattctacaaacggaatcatctcttaacttactggtgacccatcctcta
ccacgctcattttacactgggggaggaatgcaagctttgcgcgcccgcttccaaccggaa
gccctggcaaaagaaagcgtacactatgactcacttaagtcctcgcctaacgccagagtg
tctagtaaagattacttcaactacgtgcctgcaagtccaactgtcaaagctccttcctta
cctgcgatgacccccaaacctctctctcctatcatccataagtcctccttgggacagaca
gcaacgactactgttaagaatgaaccccttaatggcggctcctcccccctggatgaaaca
agggataaagttccatcatttggtctctcgacggctgcggcaaccaaccctgatgccagc
ttccgccacgcaagtccattcatccgtcgcacatcagccatgcgccaacaggtggctgct
ggtgatctcgcaatgtctgtgcataatttgcccgacgaatccggccaggcatattatcgc
ccgaccgcaatcacccctggtctgtcaaaaatggatacttggcaacgacgatattccagc
tcctggaacttgaatgactcaccccacaccgacggccaacctgtagatccacagagagat
gacgaatctcttctgaatgagtcgttcgatttgaaagaggcagtcctcaacagtatagct
aaatcaatcggactgtatcaagaggccgaaagtaattcagacatgatcgctcgctcttcc
atggctccgtcagtgagcgcgttgtcgactccaaactcacctatgtttcctcctaatgcg
ggtactccattacaaggaagtacgcgttctcgccctccgcattttggcaacgttcttgac
ctcataaacgcatctagccagaatgaaggtgtcatcggtggtatgttgcgcgaagccgct
ttcaactcccgtccggatgacgaagctagtagtatttctatgagcctccatgactctcaa
gggggagctagcggcgttgataggaagattatgaaagatctcgaacggcatgtggaaatt
ttgtttttcaagaaaggtagcgtactagtaaaagaaggagagaggtcaccaggtatgtac
tatgtgatagatggtttcctggagacatctcttcctttccgcagcacaagctccaatcag
gagaaccctaattccaccccagggagcaaacaccgccagtcaagttttggaagttcgaat
gaaaggcctttcaaaacggctctaggcctggatacttccaaaggcaaggaattagatgac
gggtcgaagaaagatgaagccttatttactgtcaagcctgggggtatcgccggttatctt
tcttccctttgctgtacagattcatatgtcgatatcacggccaaaacagattgctttgtc
gggtttcttccccaccacactctggagagaattattgagcgacgaccaattgttctattg
acattggcgaagagattgctatctctactgtcgcctcttgtcctccatattgacgcggct
ttggattggcaacaattaaatgccggacaagttctatatgagaaaggcgataaatcgacg
gacttctacatcgtcattaatggccgtcttcgagcgttcactgagaagaacgacaatatg
cacgtacttcgtgaatatggacaaaatgactctatcggcgaactcgacgtgataacggct
gtcgatcgctcagaaactgttcatgccattcgagattctgagcttgtacgtattccggcc
gcattatttgacgcaattagcattaaacacccggagacgacggttcagtttatgagattg
atcgccggtagagtgagaagggctttgggagatgagatgaacggtcgagtccctggctta
ccgactacagacatgaacctcaaaacggtgtgcgtacttggctctacgagaaatgttcca
gttacgcagttcgccggtaaactcaaaaatgctttggaggagattggggcgtctacgtcg
tacttagaccaaggcatcgtaatgcggcatcttggtaggcatgcgtttgcccgtattggt
aaacttaaggtagcaggatggcttgccgatcaagaacaacattacaggacagttctctat
gttgctgactctcctccggccagccaatggactctgacttgcatccgccaggctgatttg
gtactagtcgtttccatgggtgacgacccctctctgggcgaatacgaactaattttactc
catgacgaacggactgtcgctcctggatcgacacgtcaatggcttagcaatcgaccatgg
atacaaactcattatcacgtcgaattgcctggggtcgtgacgccagcccgccctatacct
ccggtgcacgatgcagcggccattgcggccttcaaacatcttcgcgagcaagttgaaacc
cgtataaaaaagtaccggggtctgcggccatttactcgccctcgccgtcctcctcatatg
aacgacttcgctcgtatagctcgtcgtctatgtggccaacagattggcctcgttcttggg
ggaggaggcgcacgaggaatatctcatattgggatgttacaggcgcttgaagaatttggt
atcccgatcgacgcaattggaggctgttcaattggaagctttgtaggaggcttgtacgca
agagaaactgatctattggaaacagcgggaagaactaagcaattctcggggaggatggga
tcgatgtggaggatcctaagcgatgtcacttacccatttgtttcatatacgactggtcat
gagttcaatttttggatacctttcttcgccaattcgacaaatatcacacattcgcgcatg
gaggtgcacagaaccggttatgcgtggagatatgttcgtgcttctatgactcttgccggt
ctattgccgcctctctcggacaatggaaatttacttgttgatggtggttacatggacaac
actcccattcagcctttgcgcgaaaatggtatccgcgatatcattgttgtggacgttggt
tcggtagatgacacctctccgagagactatggtgactcagtctccggatggtggatcttt
ttcaataggtttaatccattttacgaaaggagggtcctatcgatgacagaaatctcatca
cgacttacctacgtctcgagtgttaagacgttggagggtgttaaagcaacccccggctgc
cattacattgccatgcctgttcaacaattcgacactctaggcggcttcaagcgattctcc
gaagtcatggagatcggattgaaggccggtcgagagactttgaagaagtggaaggaggag
gggaagttgccaactggtttggtcgatgaagccaaaggaagcaaagccgtgcaacgtggg
aacagactcaggcgaatgtcaatctga

DBGET integrated database retrieval system