KEGG   Cryptococcus neoformans JEC21: CND04360Help
Entry
CND04360          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cne  Cryptococcus neoformans JEC21
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CND04360
   03420 Nucleotide excision repair
    CND04360
   03430 Mismatch repair
    CND04360
   03440 Homologous recombination
    CND04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(1208053..1208114,1208178..1208322,1208349..1208541,1208596..1208738,1208797..1208907,1208958..1209049,1209101..1209110))
Genome map
AA seq 251 aa AA seqDB search
MNNYDGQNPYYGGAGGGYVAGGSPYGSQDSPSRKARGGNQTIRPVTVKQILDAQQVHPDA
DFTIDGVDVAQVLLIGSVRNMSTTATNISYEIGDGTGYIDARVWLDSADDESGKTTGIEQ
DHYVGLMGTIKVFGGKRHVSATHIRPITDGNEVQHHLLKALYVSLILRGGTPGNVRDSSF
SLIAPKAAGTHDDYNAGATTGATDQSAWSHLEPLQRRILEVLSSEGQGNDDAAITEYIQT
VSDHLILQSGT
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactacgacggtcagaacccatactacggaggagccggtggaggatacgtcgcg
ggcgggtctccctacggcagccaagactcaccgagccgtaaagccagaggagggaatcag
actattaggcctgtgacggtgaagcaaatcctcgacgctcagcaagttcatcccgacgcg
gatttcacaatagacggcgtggacgtagctcaagtgcttttgatcggctctgtgcggaat
atgtcgacaaccgcgacaaacatttcctacgaaattggggacggtactggttatatcgat
gctcgtgtgtggctcgactcagcagatgatgagtcggggaagactacgggaattgaacag
gaccattatgttgggcttatgggcacaatcaaagtatttggcggcaaaaggcacgtgtct
gcaactcatatccgacctataacagacggcaatgaagttcagcaccatctcctcaaagct
ctctatgttagcttgatactgagaggtggcactcctggtaacgtacgtgattcctccttt
tctcttattgccccgaaagctgctggcacccacgatgactacaatgccggagcgactact
ggcgcaactgaccagtctgcctggtcgcatctagagcctctgcagcgtagaattctagaa
gtcttgtcgagcgaaggacagggcaatgatgatgcagcaattaccgaatatatccagact
gtatctgaccatctcatcttgcagagtggcacttga

DBGET integrated database retrieval system