KEGG   Cryptococcus neoformans JEC21: CND04800Help
Entry
CND04800          CDS       T00243                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CND04800
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CND04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(1318431..1318824,1318877..1319100,1319155..1319190))
Genome map
AA seq 217 aa AA seqDB search
MSRPINPDVVNRPLVICGPSGTGKSTLLKTLFESQPDTFGFSVSHTTRKPRPGEENGREY
HFVTKEEFMEGVGKGEFLEWAEFGGNCYGTTFAALTALHPRRCILDIELQGVLQLKAKAP
LQTPPLEPVFLFLSPPSISQLKSRLSGRGTETDASIRKRLDAAKEELRYAKEGKYDVYVV
NDDLKVAGEKLEKVAMGWEGWKTCGDVLPELNLAELD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcccatcaatccagacgtcgtcaaccgcccacttgtgatttgcggcccttct
ggtaccggaaaatctaccctcctcaagactctttttgagagccagcctgatacctttggt
ttttccgtctctcatactactcgaaagcctaggcccggggaggaaaatggccgagaatac
cactttgtcaccaaggaagagtttatggagggtgtcggcaagggcgaatttttggagtgg
gccgaattcgggggcaattgttacggaactacatttgctgccttgaccgcccttcatccc
cgccgatgcattctcgacattgaactgcaaggtgtccttcagctaaaggctaaggccccg
ctccaaacccctcccctcgaaccggtgtttctcttcctttctccgccttccatttctcaa
cttaaatcccgtttgtctgggcgaggtaccgagaccgacgcctccatccgaaagaggctc
gatgctgccaaggaggagctgaggtacgcgaaggagggcaaatatgatgtttacgttgtc
aacgatgatctgaaggtggctggcgaaaagcttgagaaagttgcgatgggttgggagggc
tggaagacttgcggtgacgtcttgccagagctgaacttggctgaacttgactaa

DBGET integrated database retrieval system