KEGG   Cryptococcus neoformans JEC21: CND05060Help
Entry
CND05060          CDS       T00243                                 

Definition
ribose-5-phosphate isomerase
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CND05060
   01230 Biosynthesis of amino acids
    CND05060
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CND05060
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CND05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:join(1382698..1382781,1382837..1382977,1383037..1383233,1383328..1383460,1383581..1383796,1383892..1383978,1384082..1384132)
Genome map
AA seq 302 aa AA seqDB search
MPSPAVDLLKQKTASLPNAPISVVAANTFVPPTQPVTAGNQLPTSVPLPVLPAVEAAKRL
AAYAAVDRHIAHEHKVIGIGSGSTVPYVVDRILAQGFEANKDRVFLPTGFQSKELIVKAG
LTLGDVDQYARIDVTIDGADEVDNELNSIKGGGACQLREKVLAEAADTWIIVADYRKNSE
VLGTSWTKGIPIEVVPFAYAKVLTNLAHMGSPHVLPNGQPGLSLRMGKMKAGPVVSDNGN
FIIDAPFAEELMRQPEELLHKIKMLTGVVEVGLFCGMAKAAYFGNEDGSVTIRSDDGTIS
QL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccctccccggccgtagaccttctcaagcaaaagacagcaagcctgccgaatgcccct
atcagcgtcgtcgctgccaacacctttgtccctcctactcagcctgtgacggctggaaac
cagctgcctacctctgtccctctccctgtcctgcctgcagttgaagctgccaaacgtttg
gcagcatatgccgctgtggaccgacacatcgcacacgagcacaaggtcattggtatcgga
tcaggatccactgtcccctacgtcgtggacagaatacttgctcaagggtttgaagccaat
aaagaccgggttttccttcctaccggcttccagtccaaagagcttatcgttaaagctggc
ttgactttgggcgacgtggatcaatatgctcgaatcgacgtgaccattgacggtgccgat
gaggtcgacaacgagctcaactccatcaagggcggcggcgcttgtcagcttcgtgaaaag
gtcctcgcagaggctgctgatacgtggatcatcgtggccgactaccgcaagaactctgaa
gttctcggcacatcttggactaaaggaattcccatcgaagtcgtcccctttgcgtacgcc
aaagtcctcaccaacctcgcccacatgggctccccacatgttcttcccaacggtcagcct
ggtcttagcttgcgtatgggtaagatgaaggctggacctgtggtcagcgataatggaaac
tttatcattgatgctcccttcgctgaggaattgatgcgacagcctgaagagctgttgcac
aagatcaaaatgttgaccggtgtcgtcgaagtcggacttttctgtggcatggccaaggct
gcgtactttggtaacgaggatggctccgttacaatccgttctgatgacggtaccatttct
cagctgtaa

DBGET integrated database retrieval system