KEGG   Cryptococcus neoformans var. neoformans JEC21: CND05060Help
Entry
CND05060          CDS       T00243                                 

Definition
(RefSeq) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00030  Pentose phosphate pathway
cne01100  Metabolic pathways
cne01110  Biosynthesis of secondary metabolites
cne01130  Biosynthesis of antibiotics
cne01200  Carbon metabolism
cne01230  Biosynthesis of amino acids
Module
cne_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cne_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CND05060
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     CND05060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A
Motif
Other DBs
NCBI-GeneID: 3257417
NCBI-ProteinID: XP_570436
UniProt: P0CR18
Position
4:join(1382698..1382781,1382837..1382977,1383037..1383233,1383328..1383460,1383581..1383796,1383892..1383978,1384082..1384132)
Genome map
AA seq 302 aa AA seqDB search
MPSPAVDLLKQKTASLPNAPISVVAANTFVPPTQPVTAGNQLPTSVPLPVLPAVEAAKRL
AAYAAVDRHIAHEHKVIGIGSGSTVPYVVDRILAQGFEANKDRVFLPTGFQSKELIVKAG
LTLGDVDQYARIDVTIDGADEVDNELNSIKGGGACQLREKVLAEAADTWIIVADYRKNSE
VLGTSWTKGIPIEVVPFAYAKVLTNLAHMGSPHVLPNGQPGLSLRMGKMKAGPVVSDNGN
FIIDAPFAEELMRQPEELLHKIKMLTGVVEVGLFCGMAKAAYFGNEDGSVTIRSDDGTIS
QL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccctccccggccgtagaccttctcaagcaaaagacagcaagcctgccgaatgcccct
atcagcgtcgtcgctgccaacacctttgtccctcctactcagcctgtgacggctggaaac
cagctgcctacctctgtccctctccctgtcctgcctgcagttgaagctgccaaacgtttg
gcagcatatgccgctgtggaccgacacatcgcacacgagcacaaggtcattggtatcgga
tcaggatccactgtcccctacgtcgtggacagaatacttgctcaagggtttgaagccaat
aaagaccgggttttccttcctaccggcttccagtccaaagagcttatcgttaaagctggc
ttgactttgggcgacgtggatcaatatgctcgaatcgacgtgaccattgacggtgccgat
gaggtcgacaacgagctcaactccatcaagggcggcggcgcttgtcagcttcgtgaaaag
gtcctcgcagaggctgctgatacgtggatcatcgtggccgactaccgcaagaactctgaa
gttctcggcacatcttggactaaaggaattcccatcgaagtcgtcccctttgcgtacgcc
aaagtcctcaccaacctcgcccacatgggctccccacatgttcttcccaacggtcagcct
ggtcttagcttgcgtatgggtaagatgaaggctggacctgtggtcagcgataatggaaac
tttatcattgatgctcccttcgctgaggaattgatgcgacagcctgaagagctgttgcac
aagatcaaaatgttgaccggtgtcgtcgaagtcggacttttctgtggcatggccaaggct
gcgtactttggtaacgaggatggctccgttacaatccgttctgatgacggtaccatttct
cagctgtaa

DBGET integrated database retrieval system