KEGG   Cryptococcus neoformans JEC21: CND05740Help
Entry
CND05740          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CND05740
Translation factors [BR:cne03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CND05740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(1548360..1548755,1548806..1549224,1549279..1549432,1549485..1550165,1550231..1550377,1550430..1550616,1550673..1550858,1550929..1551020))
Genome map
AA seq 753 aa AA seqDB search
MSAADLDYFSEDEQREIEAELDTGFKDIEEKYAVTAQKGFETMLVVDNIPIVDGSKKQRL
LERLRQTFAKVGAPIEEESIDMPWNAAAGTNKGFVFLTYPDVKEAENAVHTLDGVSFGKN
VLHVNRFGDIQRFASMPVGEGDLPSGWKEKEYIEKDYLRNWLGDIAGRDQYVTFWETEVT
VWWNGRNGTAEALKGPDGKPVKNSKWGELYLQWSTMGTYLASLHRVGVALWSGPKLDGPI
GVNVLRFTHPNVRLIQFSPCENYLVTWSEDPLPNYENHPNAALRDTFGPEDEGNQYVIWD
IKTTRVLRTFPGDKSAIGVDDTQSRMSWPTFKWSADDSYIAKCNVGAGISVYELPTMGLL
DRKSIKIEGVQDFEWCPMSQKDLIARQEGKGKECVLAFWTPEAQNQPARVNIMAVPSRTI
LRSKNLFNVSECKFYWQSQGDFLCVKVDRHARKAKSKKATSCNLEIFRMREKDYPVEVLE
FKDYVPQFAWEPSGTRFAIVLQAETNLPSVSGASTKYSIDFYQLDSKKGDFIAIKHLDSK
MANTLVWSPKGRHIALATIGSSSKYDIEFWDLDFTIDERREAAELGANVTMLGTGEHYGI
TEIAWDPSGRYIATSASTWRQSPEPGFSIWDFKGQQLLHESRDRFKQFLWRPRPPTLLSK
DQIKKVRKELREYSRQFDEEDAAEENRGSAEKLAQRRREIGEWNAWRTRNNDRLAFEREN
RGKSKAKIDVKGQEARVEEWVEELIDETEELSM
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgacctagactatttttcagaagatgagcagcgtgagattgaagctgag
ctcgacactggcttcaaggacattgaggaaaagtatgctgtgaccgcccagaagggcttt
gagacgatgttggtcgtcgacaacattcctatcgtagacggtagtaagaagcagagactg
ttggagcgattgagacagacattcgccaaagtgggcgcgcccatcgaggaggaaagtata
gacatgccttggaacgcagcagctggtactaacaaaggtttcgttttcctgacatacccc
gatgtgaaggaagcggaaaatgccgtccacactctcgacggtgtatcctttggtaaaaac
gtgctgcacgtaaatcgatttggagacattcaacgcttcgccagtatgcctgttggagag
ggcgatctgccatcgggctggaaagaaaaggagtatattgagaaggattacttgcgaaat
tggcttggggatattgctgggagagaccagtatgtaaccttctgggaaacagaggttact
gtctggtggaacggacgcaatggaaccgccgaggcattaaaggggcccgacggtaaacct
gtgaagaacagtaaatggggtgagttgtacctacagtggtccaccatgggaacctacttg
gcttcgcttcatcgtgttggcgttgccctatggtccggtcccaaactcgatggacccatt
ggcgtcaatgtgctcagattcactcaccccaatgttcggcttatccaattttccccctgc
gagaattatctcgttacctggtcagaagatcctcttccaaattatgagaatcatcccaat
gcagctctgcgagacactttcggtcctgaagacgaaggaaaccagtatgtcatttgggac
atcaagacgacacgtgttcttcggacattccctggtgataaatctgcaattggggtagat
gatactcaatcccgcatgtcgtggccaaccttcaagtggtctgcggatgactcgtatatc
gctaagtgcaatgtcggcgcggggatttcagtgtatgaactgcccactatgggattgttg
gatagaaagagtatcaaaatcgagggggtacaagactttgaatggtgtcctatgagccag
aaggatttgatagcgagacaagaaggaaagggaaaggagtgtgttctagccttctggacc
cctgaagctcagaatcagcccgctagagtgaacataatggctgtaccaagccggacgatc
ttgagatcaaagaacctgtttaatgtctctgaatgtaaattctattggcagagtcaaggt
gatttcctttgtgtaaaggttgatcgccatgctcgaaaggccaaatccaaaaaggcaact
tcgtgcaatttagaaattttccgcatgcgcgagaaagattaccctgtggaggttcttgaa
tttaaagattacgttccgcaatttgcatgggagccttcgggcactcgctttgccatcgtt
ctccaagcagaaacaaatcttccatcggtctcaggggcgtcgaccaagtacagcatcgat
ttctatcagcttgattccaagaagggagatttcatcgcaattaaacatcttgacagcaaa
atggccaatactctcgtctggtcacccaagggtcgtcatatcgcattggccaccatagga
tcgtccagcaagtatgatatcgaattctgggaccttgacttcactatcgacgaaaggcga
gaggctgctgagcttggggctaacgtaactatgttgggcactggggaacattacggcatc
acagagattgcttgggatcctagtggacggtacattgcgacttctgcatctacatggcga
cagtcccctgagcctggcttttctatttgggatttcaaaggtcaacaacttctgcacgaa
tcacgggatcgtttcaagcagttcctttggcggcctcgtcctcctacgctgcttagtaag
gatcagattaagaaggtcagaaaggaacttcgagaatattcgcgacagtttgatgaagaa
gatgctgcggaggagaaccgagggagtgccgagaagctcgcccagcgtcgcagagagatc
ggcgagtggaatgcttggaggactaggaacaacgacaggctggcttttgaacgcgagaac
agaggcaagtcaaaggcaaagatcgatgttaaagggcaggaggcacgggttgaggagtgg
gtcgaagaacttatcgatgagactgaggaattgtcgatgtaa

DBGET integrated database retrieval system