KEGG   Cryptococcus neoformans JEC21: CND06150Help
Entry
CND06150          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cne00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:join(1695965..1696236,1696283..1696435,1696487..1697097,1697147..1697242,1697290..1697793,1697843..1698000,1698056..1698203,1698272..1698593,1698661..1699153)
Genome map
AA seq 918 aa AA seqDB search
MSQPLTRRGPLQPHPSQASTFTSKVTVESEADARLRDHHSGRTAQKTAFGGKRGSAAVGR
IGKREWTMIGGMVVVALYVRLYKLGRPSSVVFDEVHFGGFAMKYIRRKFFMDVHPPLAKL
LVTLSAWIGGFDGKFDFKDIGKDYLEPGVPYITMRFFPAALGIALIPLAFLTLLALRLSH
TSALLGALLVTFDNALITQSRLILLDSFLVFFTGLTTLFWVRFSNDDSEGRAFTKPWWIN
LLCTGLSLGAVVSCKWVGLFTIAMIGVGTLRQLWLLLGNLKVTPRQYIRHFAARTLCLIV
VPLTFYMLMFRIHFWILNESGDGDGFMSSEFQHTLQGHGMADTFADVGFGSKVSIRHVNT
QGGYLHSHPHPYPGGSKQQQITLYPHRDDNNVWRIVNASAPDGPASYPWDELPFEYVLTG
TKIRLEHVTTEKRLHSHDIRPPVSEVDFQNEVSGYGFPGFAGDANDDFIVEITKRTRGKN
DKQAKHRLKTLRSEFRLRHALSGCYLFSHKVKLPDWGYEQQEVTCNKNPTWENSLWYIET
NQHVQLPIDAERVNYEKPSFFEKFFELNAVMWRTNAGLTERHAYDSRPQHWPWLRRGINF
WVKDHRQVYLIGNPVVWWSSTAAIVAYLAVRGFLVLRAQRGYRDLHQPKLAFYDDICAFC
VIGWALHYFPFYLMQRQLFLHHYLPALYFAILLFCTVFDYATSALKPKIRTNIAIVILIL
ALWSWNHWSSLAYAGEWTKGACENGKWLRTWDFSCNDFYENTSMYNSQSAISSEKIAPTD
LGPDSATTTLIEEVPEPIQNVFQQDPPPEEKTVAPVGPAPEVQMEESSAVFIPKGEEAPL
AEDLRAPVGNDAGDPAVTDGEDDGGWHGGAEEGQHRQEKDEVKIKEGKAPVGAKVDIPDM
GLDEEQKLLVDQIMDEQE
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacccctcacccgccgcggccctcttcagccccacccttcacaagcgtcgacc
tttacttcaaaagttaccgtcgaatctgaagctgatgcacgtttgagagatcaccattcc
gggcgcacagcccagaaaactgcgtttggcgggaagagaggctctgcagcggtaggacgg
attggaaagagggagtggacgatgatcggggggatggtcgtagtcgcgctttatgtgaga
ctgtacaagcttggcaggccgagcagtgtcgtctttgatgaagtgcatttcggaggtttt
gccatgaagtatatccggcgcaagttcttcatggacgtgcaccctccactggcaaaactc
ttggtcactttgagcgcgtggatcggtggattcgacgggaagtttgatttcaaagatatt
ggaaaggattatcttgaacccggcgttccctatattaccatgagattctttccggccgcc
ctcggtatcgctctcatccctctcgccttccttactcttctcgctcttcgtctttcacac
acttctgcacttctaggtgcccttcttgtcacatttgataacgccctcatcactcaatcc
cgactcatcctcctagactccttcctcgtctttttcaccggtcttactacccttttctgg
gttcgcttctccaatgatgattctgaaggccgagcgttcactaagccatggtggataaat
ttgctttgtaccggcctcagtcttggtgctgtcgtctcgtgtaaatgggtcggcctgttc
actattgccatgatcggcgtcggaacccttcgtcagctctggcttctcctcggtaatctc
aaggttacccccaggcagtacatcagacactttgcggctcgtacgctgtgcttgattgtg
gtacccttgactttctatatgctaatgtttaggattcatttctggatcttgaacgaaagc
ggagatggagatgggtttatgagctcggagttccagcatactttgcagggtcatggcatg
gctgacacttttgctgatgttggttttggttcaaaggtgtccatccgacatgttaacacc
cagggtggttacctccattcacaccctcacccttatcccgggggctctaagcagcaacaa
atcactctctacccccaccgagacgacaacaacgtttggcgaatcgttaacgcttctgcc
cccgacggaccggcctcttatccctgggacgaacttccctttgaatatgttctcaccggc
accaagattcgtctcgagcatgtcacgaccgaaaagcgccttcactcccacgacattcga
ccgcctgtcagcgaggttgatttccaaaatgaagtttctggctacggtttccccggcttt
gctggtgatgccaatgatgatttcattgtggaaatcaccaagcgcacaagaggaaagaat
gataagcaagctaaacacaggctcaagactctccgcagcgagtttaggctgaggcacgct
ttgtctggatgctacttgttctcgcacaaagtcaaattgcctgactggggttacgaacag
caagaggtgacttgtaacaagaaccctacttgggaaaactctttgtggtacattgagacc
aatcagcatgttcaattgcccatcgacgctgagcgagttaattatgagaaacccagcttc
tttgaaaagtttttcgagctcaacgctgttatgtggaggaccaacgccggtttgactgag
agacatgcttatgactctcgacctcaacattggccttggctcaggcgtggtattaacttc
tgggtcaaggaccacaggcaagtttacctcatcggtaaccccgtggtatggtggtctagt
actgccgctatcgttgcttatctcgccgtgagagggttcttggttttacgcgcccagagg
ggttacagagacttgcatcaacccaagctcgcattttacgacgatatttgtgctttctgc
gtcatcggctgggcactccattatttccccttctatcttatgcaacgtcagcttttcttg
caccattaccttcccgcactttactttgccatccttcttttctgcaccgtcttcgactat
gccacatctgcgctcaaaccaaagattaggacaaacattgctattgtgattttgatcctt
gcactttggagctggaaccattggagtagcttggcgtatgctggggagtggactaagggc
gcttgtgagaatggcaagtggttgaggacctgggatttctcttgtaacgacttttacgaa
aacactagcatgtacaactcccaatccgccatttccagcgaaaaaatcgctcctaccgat
ctcggccccgactcagccaccactacactcatcgaagaagttccagaacctatccaaaac
gtcttccagcaagatccccctcctgaggaaaagacagttgcacccgtgggccccgcgccg
gaagttcagatggaagagtcttcagcggttttcattcctaagggagaagaggcgccactc
gctgaggatctgagagcgccagtaggaaatgatgcgggtgatccggcggtgacggatggg
gaggatgacggtggttggcacggaggcgcagaggagggacaacatcgacaagaaaaggac
gaagtgaagataaaggaaggtaaggcgcctgtgggtgccaaggttgacattcctgatatg
ggattggatgaggaacaaaagttgttggtagatcaaattatggatgagcaggaataa

DBGET integrated database retrieval system