KEGG   Cryptococcus neoformans JEC21: CNE00190Help
Entry
CNE00190          CDS       T00243                                 

Definition
(RefSeq) structural constituent of nuclear pore
  KO
K14310  
nuclear pore complex protein Nup205
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNE00190
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CNE00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(38828..38965,39018..39256,39312..39399,39447..39583,39637..39777,39836..39941,39998..40147,40212..40489,40541..44375,44433..45208,45292..45496,45555..45692))
Genome map
AA seq 2076 aa AA seqDB search
MRGDMMAGLSQPLVAQLFMSRALIWNCYVKLIKKLHENWAPKHSITDIMSTLPIQQWDPD
QFSDLQHILARVLTQPTTSSLRKLYATLEQARPWLLNLTALPGVNDKDKQFVEKKLANGT
SINVTGDLLNATNALSSFLSLSHLFSSILSLQAETHRAVYPSRSTPEISIYLLHRWQTDL
LDFLKELLKVVLEQGDMMGSGWEGLKEFVEDLLGAKVTLADGGGKEGTLVDQILSQLSIL
QTKISSLLSTSSSGQGYELQQFRLTALRAEQNKLAGILALIAEGGRLGRGQVIRVLKWLA
KVERMDAVVGLVAASVWAAWKPLEVLDASDARYDVSLSFRVSIRMRTELMEEEKVAEDWC
HDIKFLKLASSLALQERWAIPRLRESIKLSWSLFYLSCIKHDPSVIQTGIDQHEMEGWLL
DSIANGAFQFLHELVISIRQERGWDEPDEVKEAGTDSLVKVALASDKGNDEFLFRQLQDL
VDILAGKKQFLRNLRNREEDALIRRSSIALSHINPNADANVYNYQTFLRLFASIYRSLPP
DSALDLWGNPTFTGTILDTRGGFPGPAFWEMLSSISSGPSCAAISYERLKDTRLPWTALF
KFYQHYIDIMPHAYEPIKTTRNPPPSLDPMPMEEVEICKGWTEVLSTVVKWSPAARGALL
QMKPHPLGVLWDFVNCENVPLHLKAAILNAITAFTSRPSQSQSEGSITTHDPMDDEVLVQ
SVGFYEKISYRDPNADVRYLEGGRIPAPVGWLIRMGFLEGEAGRYELSRAYVNFLTALLP
SPSSSSSSSTSGTVSISSTLGKPTLSSTRPRLSNTLRRGTFQVIDGILLSLKMRRYTRDS
ERWEVLDGLTAFLERAVLGFDMSELLNLGSGSGSSSSASSVGGTGGSGRGIGQIALELSE
EPGFIVILRLLSERDIFAVLAEVLDSAASLGGNRERKKIVSKVLRQVLRIYHRVMELQLV
FADVLLLALTDPSRNPVHTLKRPYGLQPLDNHLLAHLTNVNNIALLIGDDDPMISYLSTK
LIALLSNSPVFNRSDLFQGEYKGEVNRLAGVLDVSDDSIRILQGFVRRLDVESEDPEQGV
EAVEEIALHGDIEQVKEELPMVIRSVILDILIDGTSSSNTSPNIAHFLLGYDFRHRQFSF
SSEEGCLQVVLKQMLEGAGLAGSTGEGDGILEIHPQLGAKSAELVYQLFSGVLTGRATLA
YAMSVTGYSARQLASLPRQCPEWQGLVPQGSSLSAPSISTTGLGWAVTRDTKVETSSETL
VAYLEFQRWIISSASLEIFTYDGHGASASRIAQILFNGQTQALSDSGDVGDGEGENRLPP
LLIDLLNSVDVQWVEEPIDNRQLEFYASFDFDAYKRPDVDWWDIKGLGAGLTAFKKQLEG
QGAITQASIPGVDAEAEYVLRRLGGKNRETDVAIAKGNFLAAWNELLKVGLTLLFARHIT
EDHQEAILFDLLEGLLARLDGEIDLAPGVEDLLCESSLVVMTTLVGVLQKFEGVNLPVEQ
LGAVLAKVVDAATRPGSTETARGNLYAAITQYLQLIIPANSNIPDDRSISGSTVDPLASF
SSTTMLQRITLQIFAAKKERLVPGLCRDAMDDRDVWKTQCFALLGGVVSICQGERDRHVV
APLISNGYLPLFVRSVKEREGALMECLAPDAENLHAYWVFEAKIAFLIALASTRKGSEDL
LDAGIFEIFATCGFINIQLNEGMLDEYAGGEIVERQHRVLVASLQLLTRVLSSLHKSARS
GAGHAISFLNAHREAILALVREPQRNLTVTALDECRLVVSILAMVVHKVSPEDLYSPSSF
GAFHLAVLSAAAHAFDKNTWVEIAEENSKIESQMVLLNQVLLAFLTAATNGLKAGSGNPV
FITGVQRSHGSAVKYIASAPSLQMAVNLLSDLAETTEEVSNQYEVILDRMQDGSDLEEED
VEKLRNEFIGDAPLSDDLIKVAFIARSQMLFNMIESLLLLIWRHLLFYANDVRGSLAPIR
PENLSPSLSSFAMSQQAQMEASRSNAGTMKMLERVAAGLRGTLIRLDDMEVNLELRRLAT
GGGARGDAYSGMLVRRLKEIVGGLVGEREIMEEDQQ
NT seq 6231 nt NT seq  +upstreamnt  +downstreamnt
atgagaggagatatgatggcgggcttatcgcaaccgctcgtcgcccaactttttatgtca
cgtgctttaatttggaattgttacgtaaaactcataaagaagctgcacgagaattgggct
cctaaacattcaatcactgacatcatgtccaccctacccatacaacagtgggatccagac
cagttctcggatctgcaacatatactcgcccgcgtactcacacagcctaccacttcctcc
ttgcgaaaactgtacgcaactcttgagcaggcgagaccatggttgttgaacctcactgct
ttgccgggcgttaatgacaaggataagcagtttgttgagaaaaagcttgccaacgggacg
tcaataaacgtcaccggcgacctcctcaacgcaacaaacgccctctcatccttcctctct
ctttcgcacctcttctcctccatcctctctcttcaagcagaaacacaccgcgccgtctat
ccttcacgctccaccccggagatttcgatctacttgttacatagatggcagaccgattta
ctcgattttttaaaggaactgttgaaggtagtgttggagcagggggatatgatggggagt
gggtgggaggggttgaaggaatttgtggaagatttgttgggagcgaaagtgacccttgca
gatggcggtgggaaagaggggaccttggtagaccagatactcagccaactatctattctt
cagacgaaaatctcttccctcctgtccacttcgtcttcgggacagggatatgaactccaa
caattccggcttacagctctccgagctgagcagaataagttggcagggatacttgcgttg
attgcggaaggaggcagattggggaggggccaggttataagggttttgaaatggttggcc
aaggtggaaaggatggatgctgtggtgggtttggtggcagcgagcgtttgggcggcgtgg
aagcccctggaagtgctggatgcgtcggacgcgaggtatgatgtgagtttgtcttttcgt
gtttcaatacgtatgagaacggagctgatggaggaggaaaaggttgccgaggattggtgt
cacgatatcaagttcctcaagcttgcctcgagtcttgcccttcaagaacggtgggcgatc
cctcgtcttcgagaatccatcaaactctcctggtcccttttctatctatcctgcatcaaa
cacgaccccagcgtcatccagacaggtattgatcaacatgaaatggaaggatggttgctt
gactctatcgccaacggcgcattccagttcctgcacgagctagtcatctccattcgccaa
gaaaggggctgggatgagcctgacgaggtgaaggaggctggcacggattcgcttgtcaag
gttgcacttgcgtcggataaagggaatgacgagtttttgtttaggcagttgcaggattta
gttgatatcctcgccgggaagaagcagtttttgcggaatctacggaatagggaggaagac
gctttgattcgacgatcgtctattgctctttcgcacataaaccctaatgccgacgccaac
gtttataattaccaaacttttctccgcctctttgcttcaatctaccgctccctccctcct
gattctgctctcgatttgtggggaaatccgacgttcaccggcacaattctcgatactcgt
ggtggtttccccggtccagccttttgggaaatgttatcctcaatttcctctggtccttcc
tgcgctgccataagctatgaaaggctcaaagacacccgtctcccttggacagctttattc
aagttttatcaacattacatcgacatcatgccccacgcttatgaacctatcaaaacaaca
cgtaaccccccgccatcgctagaccctatgcctatggaagaggtggagatatgtaaaggt
tggacggaagtgttgagcacggtggtgaaatggtcgcccgcagcgaggggtgcgttattg
cagatgaaaccgcacccacttggtgtgctctgggatttcgtgaattgcgagaatgtgcca
ctccatttgaaggcggccatactcaatgctatcactgctttcacttctcgcccttctcaa
tctcagtcggaaggctccattaccacccacgatccaatggacgacgaagtccttgtgcag
tcagtagggttttacgaaaagatatcataccgcgatccgaatgcagatgtgaggtatctg
gaaggaggaaggataccagctccggtggggtggttgattaggatgggattcttggagggg
gaagcggggaggtacgagctgagtcgtgcttacgtcaattttctcactgcacttttacct
tctccctcttcctcatcgtcatcctctacatcgggaaccgtctcaatctcatccacatta
gggaaacctactctatcgtctactcgtcccaggttgagcaacactctgagacgcgggact
ttccaagtcatcgatgggatattactttcactcaagatgaggaggtatacgagggattca
gagagatgggaggtcctagatgggttgacagcatttttggaaagggcggtcctagggttc
gatatgagtgagcttctaaacctaggctctgggtctggttccagctctagcgcgagttct
gttggaggaacaggaggatcaggtaggggaatcggacagatcgccctggaattgagtgaa
gaacccggctttatcgtcatcctccgtctgctaagcgaacgtgatatctttgccgtcctc
gcagaggttttggacagtgccgcttctttgggcgggaacagagagaggaagaagattgtg
agcaaggttttgaggcaggtattgaggatctaccaccgtgtgatggaactccaattggtc
tttgccgacgtactcctactcgctcttaccgacccttctcgaaacccagtacatactctg
aaacgaccgtacggccttcagccgctggataaccatctcctcgcacatttgacaaacgtg
aacaatatcgctttgttgataggcgatgatgacccaatgatctcgtacctttccaccaaa
cttatcgcgttgctctccaattctccagtgttcaatcgatcagacttgttccaaggggag
tacaagggtgaggtgaatcggttggcgggggtgttggacgtttcggatgattcaatccgg
atattgcaaggatttgtgaggaggttagatgtggaaagtgaggatccggaacaaggtgtg
gaggcagtagaggagatagcgttgcatggggatatcgagcaggtcaaggaagaattaccc
atggtcattcgttcggttatcctcgacatcctgatcgatggtacatcgtcatccaacacc
tcacctaacattgctcatttccttctcggatacgatttccgtcatcgccaattctcattc
tcctctgaagaggggtgtcttcaggttgttttgaagcaaatgcttgaaggtgccggattg
gccggatcgacgggtgaaggtgatgggattttggagatacatcctcagttgggagcgaag
agtgctgaactagtgtatcagctcttctcgggagtgttgactggaagagcgacgttggcg
tacgcaatgtccgtcacgggctattcggcaaggcaactcgcctctttgccccgccagtgt
cctgaatggcaaggcctcgttccccagggcagttccctttcggccccctccatttccaca
acaggattgggatgggctgtgacaagggatacaaaggtagaaaccagctctgagaccttg
gtggcctaccttgaattccaacgatggatcatctcaagtgcctctctggagatttttacc
tatgacggccatggcgcatcggcttctcgtatcgcccagatccttttcaacggccaaaca
caagccctttccgatagtggcgacgtaggcgatggtgaaggggaaaaccggctccctccg
cttttgatcgacctcctcaactctgttgatgtacaatgggtcgaagaacctatcgataac
cgccagcttgaattctatgcgtcatttgatttcgatgcttacaaacgaccggatgtggat
tggtgggatattaagggcctcggagctggtttgacggcgttcaagaaacagctcgagggg
cagggagcgatcactcaggcgtcgatcccaggtgtagatgccgaggcagaatacgtgctt
aggcgtttgggaggaaagaacagggaaaccgacgtagcgattgcaaagggcaacttcctt
gccgcttggaacgaattgctcaaggtgggattaaccttgctcttcgctaggcacatcaca
gaagatcaccaagaagctattctcttcgaccttcttgaaggtttacttgctcgacttgac
ggagagattgaccttgctcccggtgtggaggatctgttatgtgaatcgagcttggtggtg
atgacaacattggtcggcgtgctccagaagtttgaaggagtcaatcttccagtagaacag
ctcggagcggttttggcaaaggttgtagatgctgctacgaggccgggatcgacagaaact
gcaaggggaaacttgtatgccgcgatcacacaatacctccagctcatcatcccagccaac
tctaacatccctgatgatcgatccatttccggttcaacagttgaccctctcgcttccttt
tccagtactaccatgcttcagcgcataacgcttcaaatatttgcggccaagaaggagaga
ctcgtacccgggctttgtagagacgccatggatgatcgggatgtgtggaagacgcaatgc
tttgcgttattgggtggtgtcgtcagcatttgccagggagagagggataggcacgttgtg
gcgccgttaattagcaatgggtacctgcccttgtttgtgaggagtgttaaggaaagggaa
ggggcattgatggaatgtcttgcacctgatgctgaaaacctccacgcttactgggtgttt
gaggccaagatcgcctttctaatcgctctcgcatccactcgcaagggttccgaagacctc
ctcgacgccggcatcttcgagatctttgccacatgcggcttcatcaatatccagctgaac
gagggcatgctggatgagtacgctgggggagagattgtcgagaggcagcatcgagtactg
gtggccagtctacaattgctcacccgagtgctgtcgagcttgcacaagtctgcaaggtca
ggagctggtcatgccataagtttcctcaacgctcaccgcgaagcgattcttgcgctcgtc
cgtgaacctcaacgaaaccttacagtgaccgcacttgatgaatgtcgattggtggtatct
attttggccatggttgtgcacaaggtttctcccgaggatctgtattccccgtcaagtttt
ggcgctttccaccttgctgtgttgtctgccgctgctcacgcttttgacaaaaacacttgg
gtcgaaatcgccgaggagaatagcaaaattgagtcgcagatggtacttcttaaccaagtc
ctgcttgccttcctcaccgccgccacaaatggcttgaaggctggatctgggaatcccgtg
tttatcaccggtgtacagaggagtcatggtagcgctgtcaaatatatcgcctctgctcct
tcactacaaatggccgtcaaccttctctctgaccttgccgagacgacggaagaggtgtct
aaccagtatgaggtgatccttgatcgaatgcaagacggaagcgatttggaagaagaggac
gtcgaaaagcttcgtaacgagttcattggcgatgcccccttatcagatgatttaatcaag
gttgcctttattgcaagaagccagatgttgttcaatatgattgagtcgctccttcttctc
atatggcgacatcttttattctatgccaacgacgttcggggatctcttgcccctatccgg
ccagagaacctctctccttcactcagctcattcgccatgtctcaacaagcacagatggaa
gcttcgaggtcaaatgcagggacaatgaaaatgctggaaagagtagcggcgggtctgaga
gggacgctgatacgattagatgatatggaagtgaaccttgaattgaggagactcgcgacg
ggcggaggtgcaagaggtgatgcatattctggcatgcttgtaaggaggttaaaagagata
gttgggggcctagttggtgaaagggaaattatggaggaggatcaacagtaa

DBGET integrated database retrieval system