KEGG   Cryptococcus neoformans JEC21: CNE00190Help
Entry
CNE00190          CDS       T00243                                 

Definition
structural constituent of nuclear pore
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cne03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(38828..38965,39018..39256,39312..39399,39447..39583,39637..39777,39836..39941,39998..40147,40212..40489,40541..44375,44433..45208,45292..45496,45555..45692))
Genome map
AA seq 2076 aa AA seqDB search
MRGDMMAGLSQPLVAQLFMSRALIWNCYVKLIKKLHENWAPKHSITDIMSTLPIQQWDPD
QFSDLQHILARVLTQPTTSSLRKLYATLEQARPWLLNLTALPGVNDKDKQFVEKKLANGT
SINVTGDLLNATNALSSFLSLSHLFSSILSLQAETHRAVYPSRSTPEISIYLLHRWQTDL
LDFLKELLKVVLEQGDMMGSGWEGLKEFVEDLLGAKVTLADGGGKEGTLVDQILSQLSIL
QTKISSLLSTSSSGQGYELQQFRLTALRAEQNKLAGILALIAEGGRLGRGQVIRVLKWLA
KVERMDAVVGLVAASVWAAWKPLEVLDASDARYDVSLSFRVSIRMRTELMEEEKVAEDWC
HDIKFLKLASSLALQERWAIPRLRESIKLSWSLFYLSCIKHDPSVIQTGIDQHEMEGWLL
DSIANGAFQFLHELVISIRQERGWDEPDEVKEAGTDSLVKVALASDKGNDEFLFRQLQDL
VDILAGKKQFLRNLRNREEDALIRRSSIALSHINPNADANVYNYQTFLRLFASIYRSLPP
DSALDLWGNPTFTGTILDTRGGFPGPAFWEMLSSISSGPSCAAISYERLKDTRLPWTALF
KFYQHYIDIMPHAYEPIKTTRNPPPSLDPMPMEEVEICKGWTEVLSTVVKWSPAARGALL
QMKPHPLGVLWDFVNCENVPLHLKAAILNAITAFTSRPSQSQSEGSITTHDPMDDEVLVQ
SVGFYEKISYRDPNADVRYLEGGRIPAPVGWLIRMGFLEGEAGRYELSRAYVNFLTALLP
SPSSSSSSSTSGTVSISSTLGKPTLSSTRPRLSNTLRRGTFQVIDGILLSLKMRRYTRDS
ERWEVLDGLTAFLERAVLGFDMSELLNLGSGSGSSSSASSVGGTGGSGRGIGQIALELSE
EPGFIVILRLLSERDIFAVLAEVLDSAASLGGNRERKKIVSKVLRQVLRIYHRVMELQLV
FADVLLLALTDPSRNPVHTLKRPYGLQPLDNHLLAHLTNVNNIALLIGDDDPMISYLSTK
LIALLSNSPVFNRSDLFQGEYKGEVNRLAGVLDVSDDSIRILQGFVRRLDVESEDPEQGV
EAVEEIALHGDIEQVKEELPMVIRSVILDILIDGTSSSNTSPNIAHFLLGYDFRHRQFSF
SSEEGCLQVVLKQMLEGAGLAGSTGEGDGILEIHPQLGAKSAELVYQLFSGVLTGRATLA
YAMSVTGYSARQLASLPRQCPEWQGLVPQGSSLSAPSISTTGLGWAVTRDTKVETSSETL
VAYLEFQRWIISSASLEIFTYDGHGASASRIAQILFNGQTQALSDSGDVGDGEGENRLPP
LLIDLLNSVDVQWVEEPIDNRQLEFYASFDFDAYKRPDVDWWDIKGLGAGLTAFKKQLEG
QGAITQASIPGVDAEAEYVLRRLGGKNRETDVAIAKGNFLAAWNELLKVGLTLLFARHIT
EDHQEAILFDLLEGLLARLDGEIDLAPGVEDLLCESSLVVMTTLVGVLQKFEGVNLPVEQ
LGAVLAKVVDAATRPGSTETARGNLYAAITQYLQLIIPANSNIPDDRSISGSTVDPLASF
SSTTMLQRITLQIFAAKKERLVPGLCRDAMDDRDVWKTQCFALLGGVVSICQGERDRHVV
APLISNGYLPLFVRSVKEREGALMECLAPDAENLHAYWVFEAKIAFLIALASTRKGSEDL
LDAGIFEIFATCGFINIQLNEGMLDEYAGGEIVERQHRVLVASLQLLTRVLSSLHKSARS
GAGHAISFLNAHREAILALVREPQRNLTVTALDECRLVVSILAMVVHKVSPEDLYSPSSF
GAFHLAVLSAAAHAFDKNTWVEIAEENSKIESQMVLLNQVLLAFLTAATNGLKAGSGNPV
FITGVQRSHGSAVKYIASAPSLQMAVNLLSDLAETTEEVSNQYEVILDRMQDGSDLEEED
VEKLRNEFIGDAPLSDDLIKVAFIARSQMLFNMIESLLLLIWRHLLFYANDVRGSLAPIR
PENLSPSLSSFAMSQQAQMEASRSNAGTMKMLERVAAGLRGTLIRLDDMEVNLELRRLAT
GGGARGDAYSGMLVRRLKEIVGGLVGEREIMEEDQQ
NT seq 6231 nt NT seq  +upstreamnt  +downstreamnt
atgagaggagatatgatggcgggcttatcgcaaccgctcgtcgcccaactttttatgtca
cgtgctttaatttggaattgttacgtaaaactcataaagaagctgcacgagaattgggct
cctaaacattcaatcactgacatcatgtccaccctacccatacaacagtgggatccagac
cagttctcggatctgcaacatatactcgcccgcgtactcacacagcctaccacttcctcc
ttgcgaaaactgtacgcaactcttgagcaggcgagaccatggttgttgaacctcactgct
ttgccgggcgttaatgacaaggataagcagtttgttgagaaaaagcttgccaacgggacg
tcaataaacgtcaccggcgacctcctcaacgcaacaaacgccctctcatccttcctctct
ctttcgcacctcttctcctccatcctctctcttcaagcagaaacacaccgcgccgtctat
ccttcacgctccaccccggagatttcgatctacttgttacatagatggcagaccgattta
ctcgattttttaaaggaactgttgaaggtagtgttggagcagggggatatgatggggagt
gggtgggaggggttgaaggaatttgtggaagatttgttgggagcgaaagtgacccttgca
gatggcggtgggaaagaggggaccttggtagaccagatactcagccaactatctattctt
cagacgaaaatctcttccctcctgtccacttcgtcttcgggacagggatatgaactccaa
caattccggcttacagctctccgagctgagcagaataagttggcagggatacttgcgttg
attgcggaaggaggcagattggggaggggccaggttataagggttttgaaatggttggcc
aaggtggaaaggatggatgctgtggtgggtttggtggcagcgagcgtttgggcggcgtgg
aagcccctggaagtgctggatgcgtcggacgcgaggtatgatgtgagtttgtcttttcgt
gtttcaatacgtatgagaacggagctgatggaggaggaaaaggttgccgaggattggtgt
cacgatatcaagttcctcaagcttgcctcgagtcttgcccttcaagaacggtgggcgatc
cctcgtcttcgagaatccatcaaactctcctggtcccttttctatctatcctgcatcaaa
cacgaccccagcgtcatccagacaggtattgatcaacatgaaatggaaggatggttgctt
gactctatcgccaacggcgcattccagttcctgcacgagctagtcatctccattcgccaa
gaaaggggctgggatgagcctgacgaggtgaaggaggctggcacggattcgcttgtcaag
gttgcacttgcgtcggataaagggaatgacgagtttttgtttaggcagttgcaggattta
gttgatatcctcgccgggaagaagcagtttttgcggaatctacggaatagggaggaagac
gctttgattcgacgatcgtctattgctctttcgcacataaaccctaatgccgacgccaac
gtttataattaccaaacttttctccgcctctttgcttcaatctaccgctccctccctcct
gattctgctctcgatttgtggggaaatccgacgttcaccggcacaattctcgatactcgt
ggtggtttccccggtccagccttttgggaaatgttatcctcaatttcctctggtccttcc
tgcgctgccataagctatgaaaggctcaaagacacccgtctcccttggacagctttattc
aagttttatcaacattacatcgacatcatgccccacgcttatgaacctatcaaaacaaca
cgtaaccccccgccatcgctagaccctatgcctatggaagaggtggagatatgtaaaggt
tggacggaagtgttgagcacggtggtgaaatggtcgcccgcagcgaggggtgcgttattg
cagatgaaaccgcacccacttggtgtgctctgggatttcgtgaattgcgagaatgtgcca
ctccatttgaaggcggccatactcaatgctatcactgctttcacttctcgcccttctcaa
tctcagtcggaaggctccattaccacccacgatccaatggacgacgaagtccttgtgcag
tcagtagggttttacgaaaagatatcataccgcgatccgaatgcagatgtgaggtatctg
gaaggaggaaggataccagctccggtggggtggttgattaggatgggattcttggagggg
gaagcggggaggtacgagctgagtcgtgcttacgtcaattttctcactgcacttttacct
tctccctcttcctcatcgtcatcctctacatcgggaaccgtctcaatctcatccacatta
gggaaacctactctatcgtctactcgtcccaggttgagcaacactctgagacgcgggact
ttccaagtcatcgatgggatattactttcactcaagatgaggaggtatacgagggattca
gagagatgggaggtcctagatgggttgacagcatttttggaaagggcggtcctagggttc
gatatgagtgagcttctaaacctaggctctgggtctggttccagctctagcgcgagttct
gttggaggaacaggaggatcaggtaggggaatcggacagatcgccctggaattgagtgaa
gaacccggctttatcgtcatcctccgtctgctaagcgaacgtgatatctttgccgtcctc
gcagaggttttggacagtgccgcttctttgggcgggaacagagagaggaagaagattgtg
agcaaggttttgaggcaggtattgaggatctaccaccgtgtgatggaactccaattggtc
tttgccgacgtactcctactcgctcttaccgacccttctcgaaacccagtacatactctg
aaacgaccgtacggccttcagccgctggataaccatctcctcgcacatttgacaaacgtg
aacaatatcgctttgttgataggcgatgatgacccaatgatctcgtacctttccaccaaa
cttatcgcgttgctctccaattctccagtgttcaatcgatcagacttgttccaaggggag
tacaagggtgaggtgaatcggttggcgggggtgttggacgtttcggatgattcaatccgg
atattgcaaggatttgtgaggaggttagatgtggaaagtgaggatccggaacaaggtgtg
gaggcagtagaggagatagcgttgcatggggatatcgagcaggtcaaggaagaattaccc
atggtcattcgttcggttatcctcgacatcctgatcgatggtacatcgtcatccaacacc
tcacctaacattgctcatttccttctcggatacgatttccgtcatcgccaattctcattc
tcctctgaagaggggtgtcttcaggttgttttgaagcaaatgcttgaaggtgccggattg
gccggatcgacgggtgaaggtgatgggattttggagatacatcctcagttgggagcgaag
agtgctgaactagtgtatcagctcttctcgggagtgttgactggaagagcgacgttggcg
tacgcaatgtccgtcacgggctattcggcaaggcaactcgcctctttgccccgccagtgt
cctgaatggcaaggcctcgttccccagggcagttccctttcggccccctccatttccaca
acaggattgggatgggctgtgacaagggatacaaaggtagaaaccagctctgagaccttg
gtggcctaccttgaattccaacgatggatcatctcaagtgcctctctggagatttttacc
tatgacggccatggcgcatcggcttctcgtatcgcccagatccttttcaacggccaaaca
caagccctttccgatagtggcgacgtaggcgatggtgaaggggaaaaccggctccctccg
cttttgatcgacctcctcaactctgttgatgtacaatgggtcgaagaacctatcgataac
cgccagcttgaattctatgcgtcatttgatttcgatgcttacaaacgaccggatgtggat
tggtgggatattaagggcctcggagctggtttgacggcgttcaagaaacagctcgagggg
cagggagcgatcactcaggcgtcgatcccaggtgtagatgccgaggcagaatacgtgctt
aggcgtttgggaggaaagaacagggaaaccgacgtagcgattgcaaagggcaacttcctt
gccgcttggaacgaattgctcaaggtgggattaaccttgctcttcgctaggcacatcaca
gaagatcaccaagaagctattctcttcgaccttcttgaaggtttacttgctcgacttgac
ggagagattgaccttgctcccggtgtggaggatctgttatgtgaatcgagcttggtggtg
atgacaacattggtcggcgtgctccagaagtttgaaggagtcaatcttccagtagaacag
ctcggagcggttttggcaaaggttgtagatgctgctacgaggccgggatcgacagaaact
gcaaggggaaacttgtatgccgcgatcacacaatacctccagctcatcatcccagccaac
tctaacatccctgatgatcgatccatttccggttcaacagttgaccctctcgcttccttt
tccagtactaccatgcttcagcgcataacgcttcaaatatttgcggccaagaaggagaga
ctcgtacccgggctttgtagagacgccatggatgatcgggatgtgtggaagacgcaatgc
tttgcgttattgggtggtgtcgtcagcatttgccagggagagagggataggcacgttgtg
gcgccgttaattagcaatgggtacctgcccttgtttgtgaggagtgttaaggaaagggaa
ggggcattgatggaatgtcttgcacctgatgctgaaaacctccacgcttactgggtgttt
gaggccaagatcgcctttctaatcgctctcgcatccactcgcaagggttccgaagacctc
ctcgacgccggcatcttcgagatctttgccacatgcggcttcatcaatatccagctgaac
gagggcatgctggatgagtacgctgggggagagattgtcgagaggcagcatcgagtactg
gtggccagtctacaattgctcacccgagtgctgtcgagcttgcacaagtctgcaaggtca
ggagctggtcatgccataagtttcctcaacgctcaccgcgaagcgattcttgcgctcgtc
cgtgaacctcaacgaaaccttacagtgaccgcacttgatgaatgtcgattggtggtatct
attttggccatggttgtgcacaaggtttctcccgaggatctgtattccccgtcaagtttt
ggcgctttccaccttgctgtgttgtctgccgctgctcacgcttttgacaaaaacacttgg
gtcgaaatcgccgaggagaatagcaaaattgagtcgcagatggtacttcttaaccaagtc
ctgcttgccttcctcaccgccgccacaaatggcttgaaggctggatctgggaatcccgtg
tttatcaccggtgtacagaggagtcatggtagcgctgtcaaatatatcgcctctgctcct
tcactacaaatggccgtcaaccttctctctgaccttgccgagacgacggaagaggtgtct
aaccagtatgaggtgatccttgatcgaatgcaagacggaagcgatttggaagaagaggac
gtcgaaaagcttcgtaacgagttcattggcgatgcccccttatcagatgatttaatcaag
gttgcctttattgcaagaagccagatgttgttcaatatgattgagtcgctccttcttctc
atatggcgacatcttttattctatgccaacgacgttcggggatctcttgcccctatccgg
ccagagaacctctctccttcactcagctcattcgccatgtctcaacaagcacagatggaa
gcttcgaggtcaaatgcagggacaatgaaaatgctggaaagagtagcggcgggtctgaga
gggacgctgatacgattagatgatatggaagtgaaccttgaattgaggagactcgcgacg
ggcggaggtgcaagaggtgatgcatattctggcatgcttgtaaggaggttaaaagagata
gttgggggcctagttggtgaaagggaaattatggaggaggatcaacagtaa

DBGET integrated database retrieval system