KEGG   Cryptococcus neoformans JEC21: CNE00350Help
Entry
CNE00350          CDS       T00243                                 

Definition
Mitogen-activated protein kinase CPK1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(82523..82673,82848..83041,83166..83220,83321..83452,83551..83688,83782..83920,84055..84159,84274..84356,84449..84657)
Genome map
AA seq 401 aa AA seqDB search
MSTSTRRHVLEDKLANHKADPNAAANAGQVQERTTKGSSSSAPRKVRFNVGNNYHVVDVI
GEGAYGVVASAVHRPSGTKVAIKKIAPFDHSMFALRTLRELKLLKYFAEEGVSENIISVL
DIIKPPSYDTFKEVYLVQELLETDLHRVIRTQDLSDDHCQYFLYQTCRALKALHSAEIIH
RDLKPSNLLLNANCDLKVCDFGLARSTQTAFPAEGNNQGFMTEYVATRWYRAPEVMLSFR
MYTKSIDVWSVGCILAEMLSGKPLFPGKDYHNQLALILDVLGTPTIDEFHAITSKRSKDY
IRSLPFRKKRTFESIYPSANPLAIDFLRKTLTFDPRKRYTVEQCLAHPYLDAYHDPEDEP
SAKPLPPSFFEFDMMKDDISREELKRLLYEEIMGFRPVLEG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtctactcgccgccatgtcctagaggacaagctcgccaatcacaaagctgac
cccaacgcagctgcaaacgctggccaggtgcaggagcgtacgaccaagggttcttcttcc
tccgcccctcgcaaagtcaggttcaacgtcggcaacaactaccacgtagtcgatgtcatt
ggcgaaggcgcctatggggtagtcgcttccgccgtccaccgcccatcaggtaccaaagta
gctatcaagaagattgcgccgtttgatcattcaatgtttgcgttgagaacattgagagag
ttgaagttgttgaagtactttgcggaggaaggtgttagtgagaatattatctcagtgctg
gatatcatcaaaccaccttcttacgacacttttaaagaagtctacctcgtccaagaactt
ctcgaaacagatcttcatcgcgtgatccgaacccaagacctgagcgacgaccattgtcaa
tatttcttataccaaacatgtagagctttgaaggctttgcattctgctgaaatcatccat
cgcgacttgaaaccatccaacctcttgctcaatgccaactgtgatctcaaagtatgcgat
ttcggactcgcacggtcgacacaaaccgccttcccggcggagggcaataaccagggattc
atgacggagtatgtcgcaacaaggtggtatagagcaccagaagttatgctttcgtttcga
atgtacaccaagtcaattgacgtatggtcagtggggtgtatactcgcagagatgttgagt
ggaaaaccccttttcccggggaaagattaccacaatcaactagctctcatccttgatgtg
ttgggtacacctactattgatgaatttcatgccatcacttcaaagaggtcaaaagattat
atccgatcgttgccattccgaaagaagaggacgttcgaaagtatttacccgagcgcgaac
ccgctcgctatcgatttcttgagaaagacacttactttcgacccccgcaaacggtacaca
gtcgaacaatgtctcgcccacccttacctcgacgcctaccacgacccggaagacgaaccg
tccgcgaaaccgctcccaccctcgttctttgagtttgatatgatgaaagatgatatttcg
agggaagagttgaagaggctgttgtacgaggagattatggggtttcgtccggttttggag
gggtag

DBGET integrated database retrieval system