KEGG   Cryptococcus neoformans JEC21: CNE00520Help
Entry
CNE00520          CDS       T00243                                 

Definition
mitogen-activated protein (MAP) kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNE00520
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CNE00520
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CNE00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(137482..137573,137644..137760,137831..137909,137960..137979,138046..138106,138169..138264,138360..138483,138539..138601,138659..138700,138768..138805,138857..138904,138963..139054,139111..139168,139227..139329,139391..139458)
Genome map
AA seq 366 aa AA seqDB search
MTIDQSQINFNVPSTYKLEEIVGEGAYGLVVAGTHLPSGTQVAIKRITPFDHTMFCQRTL
REIKLLRHFHHENIISILDLIQPESYEVFNEVYLVQELMETDLHRVIRSQELSDDHCQYF
VYQTLRGLKALHSADVLHRDLKPSNLLLNANCDLKICDFGLARSSAKPPPGTSDGGQGFM
TEYVATRWYRAPEVMLSFQEYTKAIDLWSVGCILAEMINGKPLFPGRDYHHQLSLILQVL
GTPTMDDFNEITSQRSKDYLRALEFTRRQDFSAICPKAKPAAVDLLKQTLTFSPSKRITV
EEALMHSYVEAYHDPHDEPNAEPLKPGFFDFEFHQEKLSRDQWKRMIYDEVQDPVPTILS
QWTESH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaccaaagccaaatcaacttcaatgttccttctacttataagctcgaagag
atcgtgggtgaaggtgcatatggtcttgtagtagctggcacccaccttccctctgggact
caagtcgctatcaagcgtatcacgccatttgaccataccatgttctgccaacgaacgttg
agagagatcaagcttcttaggcattttcatcacgaaaatatcatttccattcttgacctg
attcaaccagaaagctatgaggtattcaacgaagtctatctcgtccaggaacttatggag
actgatttgcaccgagtgatcagaagtcaggaactatcagatgatcactgccaatacttt
gtctaccagactcttcggggtctgaaagccctccattctgccgacgtccttcaccgtgat
ctcaaaccctcaaaccttctgttaaacgccaattgtgacctcaaaatctgtgatttcggt
cttgcccgatcatctgccaagcctccacctggtacatcagacggaggacagggattcatg
acggaatatgtcgctacaagatggtatcgagcgcccgaagtcatgctatcattccaagaa
tataccaaggctatcgatttgtggagtgtaggctgcattcttgctgaaatgatcaacggc
aagccgttattccctgggagagattaccaccaccaattatctttgattttacaagtgctc
ggtacccctactatggacgacttcaacgagatcacctctcaacgatcaaaggattatctt
cgagcactagagttcacccgacgtcaagacttttctgcgatttgccctaaagccaagcct
gcggcggttgatcttttaaaacaaaccctcaccttttccccgtccaagaggatcacagtg
gaagaagcgttgatgcattcttacgtcgaagcttatcacgacccgcatgacgaacctaat
gctgaacccctaaaacccggattctttgactttgagttccatcaagagaaattgagtaga
gatcaatggaaacgaatgatttacgatgaggtgcaagatccggtacccaccatcctctct
caatggacggaaagccattaa

DBGET integrated database retrieval system