KEGG   Cryptococcus neoformans var. neoformans JEC21: CNE00580Help
Entry
CNE00580          CDS       T00243                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne00480  Glutathione metabolism
cne00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CNE00580
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNE00580
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNE00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 3257824
NCBI-ProteinID: XP_570772
UniProt: Q5KHB8
Position
5:complement(join(155352..155457,155536..155672,155760..155901,155972..156021,156088..156210))
Genome map
AA seq 185 aa AA seqDB search
MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGF
TPQYTGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINKEGKCVGRYGSSTKPEKLKEE
IEKLL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttttcgacagcatcgcctccaagtttggttacgaatctctcccaggggacgtt
gccaacaaaagcttctacgatttgaaagccaagctgcctgggagcaagggtgatttggac
ttttctactttgaaaggcaaggttgtgttgatcgtcaacactgcttccaaatgtggtttc
actccccagtataccggccttgaagagctccacaagacttatggagataagggtctcgtc
gtccttggtttcccttccaacgagtttggaggacaagagcctggctctgacgatgatatc
gcccagttttgtaccctcaaccacggtgtcactttcccgcttatgaagaagtctgaagtg
aacggaaagaacatgaatgaggtctttgcgtggttgaagtctcagaagggagagaatgtt
ggtggtcttgccgggaccactgctatcaagtggaactttaccaaattccttatcaacaag
gagggcaagtgtgtcggccgatatggctcttccaccaagcccgagaagctcaaggaggaa
atcgagaagcttctttaa

DBGET integrated database retrieval system