KEGG   Cryptococcus neoformans JEC21: CNE01600Help
Entry
CNE01600          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNE01600
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNE01600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(440222..441379,441437..441597,441647..441841,441898..442481,442525..442613)
Genome map
AA seq 728 aa AA seqDB search
MSAFRKFVGNKNAGISASEGDQDPTDASLLPRANADEERLWGIENFSNSCFCNSVLQALY
ACSTFRDFVEAYPDILPPRRPIGPSQVEKRYPSVEWDGPVPGWDPSIRLNKEHRAFIALQ
EANTSMTPGGKEKRNWMGRKMSSAQSAPTLATLQASQPEPLPSLPNPFPNFDDPLLVRTP
ASDNDPPLTLFQTFQTLFYYFSHSPPHMPIKGKGQTKDSEGALIEYTEEEKVDDSGVEVP
EKASSSNQGQPAQSTSASSQQTQSQGQNAQSSGPSKLASLPPPSTFRETGAWRAGQLGWG
VVQPNDVMDAVKRSAPSFNNDDQHDAHEFFSVVVNTLAKEVDAVNEKLRAQGKEVAKMTA
PWAKTFVEALFQGITTSETKCLSCETISSRDEEFIDLSVDIEQHCSITSCLRQFSSDEMM
SGREKFSCESCSGHQEAKRSIRIKRLPPILAVHLKRFAHNESYRAIKLFYRVNHPTTLIP
PNTTDNCENPDQIYDLVAIMVHIGNGPVQGHYVTVKRTPSGRWVMCDDDNIEAIEENQLE
YWLGNRTQGQGYVLFYQARGITAEHLGLKVEKRKPNGVFEPVGEGVRYADGYGQAPAMAP
VASATLNNVRTVNGVREEEEEEVASSSGSISVSVPGLKPLSLASPVSSPSATPSSVGSRV
DRQLGFNTPANGVAHESTARPPLKKELSDKKWFRRMSMSAKTNRLMAFLTEVLPPLPSAG
RTRHPRRT
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctttccgcaagtttgtcggtaacaaaaacgcgggcatatctgcatcagagggt
gatcaagatccaaccgatgcatccttgctaccgcgcgcaaacgccgacgaagagcgtctg
tgggggatagaaaacttctccaactcttgcttctgcaactcagttttgcaagctctatac
gcgtgttccacgttccgcgatttcgtggaagcttatcccgatatcctgccgcctcggcga
ccgattggaccttcacaggtggaaaaaaggtatcccagcgtcgaatgggatggcccagtt
ccgggatgggacccatccattagactaaataaggaacatagggctttcattgccctgcag
gaggcgaatacttcaatgactcctggcggaaaggaaaaaaggaattggatgggtcggaaa
atgtcttccgcacaatccgctccgacattggcgacccttcaagccagccagcccgaacca
cttccaagtttaccaaaccctttccccaattttgacgatcctctgctggtcagaacgcct
gcatcggacaatgacccgcctcttacattgttccagactttccagacgcttttctactat
ttctcacattctccgcctcacatgcccatcaaaggcaagggtcagacgaaggactctgaa
ggcgctctcattgagtataccgaagaggaaaaagtggatgattcgggtgtcgaggtgcct
gagaaagcctcttcatcgaatcaaggccagcccgctcaatcaacttcagcatcgtcgcag
caaactcagagtcaaggccagaacgctcagtcttcaggtccttcgaaacttgcctccctt
ccaccgccctccacatttcgtgaaacaggtgcttggcgagcaggtcagcttggctggggt
gttgtccagcctaacgacgtcatggatgctgtcaagcgctctgcgccatctttcaacaac
gacgatcaacatgatgcacacgaattcttcagtgttgtagtcaacactctcgccaaagaa
gtcgacgctgtcaatgaaaaattgagagcgcaagggaaagaagtggcgaagatgactgcg
ccctgggcaaagacatttgtcgaagcactatttcaaggtatcactaccagtgagacaaag
tgtctgagctgcgaaacaatatcttctcgagacgaagaattcattgatttgtctgtggat
attgagcagcactgctctatcacctcctgcctccgccaattttcctcagacgaaatgatg
tccggaagggagaaattctcttgcgagtcctgttctggtcatcaagaggcgaagagaagc
attaggatcaaacggctcccgcctatcttagctgtccatctgaaaagatttgcccacaat
gagagttatagagccatcaagttgttttaccgggtaaatcatcccacgactctgatccca
cccaacacaacagataattgtgaaaaccccgaccaaatttatgaccttgtggcgattatg
gtgcacattggaaacggtcctgttcaaggccattatgtaacggtcaagcgaacgccttct
ggtcgttgggtcatgtgtgatgacgataatattgaggccattgaggaaaatcagctagag
tactggcttggtaaccgcacccagggccaaggctatgtcttattttatcaggcgcggggc
atcactgccgaacacttgggtttgaaagtggaaaagcgaaagcccaatggagtatttgag
cccgttggagagggcgtcagatatgctgatggttatggacaagctcccgctatggcgccg
gtagcctcagctaccctgaataatgtcaggactgtgaatggtgtaagggaggaagaggaa
gaggaagtcgcctcgagttcggggtcaatttcagtctctgtacctggtctaaagccgttg
tcattggcttcgccagtctcgtcaccttccgctacacccagcagtgttggctcccgcgtt
gatcgccaacttggcttcaatacacccgcaaatggggtagcgcatgagtctacggcacga
ccaccactcaaaaaggaacttagcgacaaaaaatggtttcgtcgcatgtccatgtcagca
aagacaaaccggttaatggcctttctaacggaggtactaccccccttgccgagtgccgga
cggacacgtcatcctcggcggacgtga

DBGET integrated database retrieval system