KEGG   Cryptococcus neoformans JEC21: CNE01930Help
Entry
CNE01930          CDS       T00243                                 

Definition
mitogen-activated protein kinase kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cne00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CNE01930
Enzymes [BR:cne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     CNE01930
Protein kinases [BR:cne01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   CNE01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(518751..518895,518954..519888,519941..520357,520408..520643,520699..520831)
Genome map
AA seq 621 aa AA seqDB search
MDNTVAPSKGKKPGGARPNPGTRPESGGPARPTGAGGVPKLSIPPDNVPGMHVDQAGQGG
WHQPASLPSLALRPMRPSPTPSSSSRPKLSLTPLTPTIPASSSSAPSSASPAPPNRPALL
NAHSARGYGERNTPSLKLSIPGASSVGPGFSTEHDYPLELPDDTDALSSELKTPTPGRPA
GGGLNLSLSSLSLTSSEDANPTLQARGRDYDEGESSYGYGCVGNGLIGPGGDAISAMTED
IRQALSRNRFETGSDRGGARSRAGSLMSDSSRATAGRDRSDSASLYNAASRRESPSASLS
GGSARQSLDLPRAAEEVNEQKESPVFDPEGLVMMRRLGEGTGGSVDMVQDRATGRIMAKK
VITRTSNPMVHKQLLRELEILNSCASPFIVEHYGSFLADHDSSIGILMEYCEAGSLDSLL
GKMKKKSMRCSEHVLGRVASSVLKGLDYLHQRRIVHRDIKPSNILITRQGAVKLCDFGVS
GELVESLAGTFTGTSFYMAPERIQNKPYSIKADVWSLGMTLHEIAHLRFPFPPEGENQSV
APIELLSYIVTAPVPVMIDDLSVGRVWSEPIKDFMGQCLIRSGTDRPYPWQLLQHPFIVA
SEAKKVNMAKWVAALCNWPLS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggataatactgttgcgccatctaaaggcaaaaagcccggaggcgccagacccaaccct
ggcactcgacctgaaagcggtgggccagccaggccaaccggggcgggtggtgtgccaaag
ctcagtatacctccggacaacgtccccggtatgcatgttgaccaagcaggccagggagga
tggcatcagcccgcctctcttccatctcttgctctccgtccgatgcgcccttctccaacc
ccttcgtcgtcgtctcgccctaaactatctctgaccccgcttaccccgactattcctgct
tcgtcaagctctgctccttcttcagcgtccccagctcctcccaataggccagcactcttg
aacgctcattctgctagaggatatggggagagaaacacaccaagcttaaaactttccatt
ccaggagccagctccgtcggaccgggcttctccaccgagcacgactaccctcttgaactg
ccggacgataccgacgcattatcctctgaactgaagacgccgacgcctggacgtcctgct
ggaggaggcttgaatctaagtctgtcttccctttcacttacatcttccgaagatgcgaac
cccacactacaagctcgcggaagggactatgatgaaggagaatcatcgtatggttacggg
tgtgtgggtaacggtctgattggacctggaggtgatgcgatcagtgccatgacggaggat
attagacaagcattatctcgaaaccggtttgaaactgggtccgatagaggaggagcgagg
agccgagcaggcagcttgatgagcgatagtagccgggctaccgcaggacgtgatcggtca
gattcggcatcactgtataacgcagcttcaaggcgtgaatcaccgtctgctagcctatct
ggaggatctgcaagacaaagtctggatctaccgcgagcagcagaagaggtgaacgagcaa
aaggaatcaccagtatttgatcctgaaggactggtaatgatgagaaggctcggtgaaggg
actggtggctcagtggatatggtacaggaccgagccacaggtcgcattatggccaagaag
gttatcactcgaacctcgaacccaatggtgcacaagcagctccttcgtgaactagagatt
cttaactcttgcgcttcgccgtttattgtggaacattatggatctttcttggcggatcat
gattcatcaataggaattctcatggagtactgcgaagccggcagtctggatagtcttctg
ggtaagatgaagaagaagagtatgaggtgttccgaacatgtcctgggtagagttgcgtct
tcggtgttgaaaggtcttgactatctccaccaacggcggatcgttcaccgagacatcaaa
ccctccaatatccttatcactcgacagggggccgtcaagctttgtgattttggagtcagt
ggagagctggtagagtctttggcggggacttttactgggacaagcttttacatggcccct
gaaagaatacaaaacaagccttactcgatcaaggcggacgtttggtctctcggcatgacc
ttgcacgagatcgcccacctccgattcccatttcctcccgagggcgaaaatcaatcagta
gcacctatagagttattgtcatacattgtgacggcacccgtaccggtaatgatcgatgat
ctaagtgtggggagggtgtggagcgagcctatcaaagatttcatgggacaatgcttgata
agatcgggaacagataggccctacccttggcaactactgcagcatcccttcattgtcgcc
agtgaagctaaaaaggtgaacatggccaaatgggtagcagccctttgcaactggcctcta
tcatag

DBGET integrated database retrieval system