KEGG   Cryptococcus neoformans JEC21: CNE02610Help
Entry
CNE02610          CDS       T00243                                 

Definition
nucleoside-diphosphate kinase
Orthology
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cne00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cne00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(701302..701356,701410..701471,701519..701556,701613..701714,701766..701832,701895..701994,702209..702243))
Genome map
AA seq 152 aa AA seqDB search
MSTTEQTYIMIKPDGVQRGLVGEIIGRFEKRGFKLVALKLHTPSKEHLEKHYSDLSEKPF
FPRLIEYMMSGPVVCMVWEGLDAVKTGRVMLGATNPLASAPGTIRGDYALQVGMNVCHGS
DSVENGQKEIALWFPEGINQYKLSSQAWLYEA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccactgagcagacctacatcatgatcaagcctgacggcgtccagcgaggcctc
gtcggcgagattatcggccgattcgagaagcgaggtttcaagctcgttgctctcaagctc
cacactccttccaaggaacacctcgagaagcactactctgacctctccgagaagcccttc
ttccctcgtctcattgagtacatgatgtccggccctgttgtctgcatggtctgggaaggt
cttgacgccgtcaagactggtcgagtcatgctcggtgctaccaaccctcttgcctctgct
cctggcaccatcaggggtgactacgctctccaggtcggcatgaacgtctgccacggttcc
gactctgttgagaacggtcagaaggagatcgccctctggttccctgagggtatcaaccag
tacaagctctcttctcaggcttggctctacgaggcttaa

DBGET integrated database retrieval system