KEGG   Cryptococcus neoformans JEC21: CNE02630Help
Entry
CNE02630          CDS       T00243                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cne00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:join(705871..706242,706306..706583,706657..706860,706916..707704,707761..707851)
Genome map
AA seq 577 aa AA seqDB search
MASRTEMESDDLLSFEKSLFLPRNATPRPYISRTEHNCHRYRSVVIKGLFLCLLILSAIV
ISVSLGLWPHYLNSRSVRFDHWSGHQNVFLESRILANIGPGIGAKEGLVVASPSKGHGKE
PDYYYTWTHDSALTISTLIPHLRFDLADINNTTEPWELYSALSDVLKEYLFRDYIESQAE
IQIGKNPSGDLKKGGLNEPKFHVDGTPFTGNWGRPQRDGPALRAIAVMIYANFLLDRGFP
SDVSYVQQRIYDPRHLKSPGRVLKNDLEEVAHGWSKGGFDLWEEVDGHHLFTLLVSRKAL
YDGSTFAKRLNDVGAADHYLAQAHSITQKLSSFWDSKRGYWLSSLSGRDFELVQLKSEFN
FTNAYPRREWLDCSIPLSIIHAGSHTLQPSHNFSFPFSATDPSVLSTIHLYIKSFDGLYS
INDGKPWSDGWALGRYKEDVYDGKGQSQGNPWFICTFSVAHSLYLAYKEFREAGAIVIAN
QTVAFWEDVVSISSKPPKVREGDVWTEGEDWQFKEGMKCLKDVAGRFMEVGQQVAAANGG
RMSEQIDRDDGQCRGARDLTWSYASLLDLIRVRSDLD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagaacagagatggaatccgacgatcttctctcattcgaaaagagcctgttc
ctacccagaaatgcgacgccgcgcccatacatttctagaactgaacacaactgtcacagg
tataggagtgtggtcatcaaggggctatttctctgccttctcatattatctgcgatagtt
atcagcgtctctctaggactttggccccattatttgaattcgcggtcggtacgctttgac
cactggagtggtcaccaaaatgtttttttggagtctagaattttggcgaatataggacca
gggataggcgcaaaggaagggcttgtagtggccagtcctagtaagggacatggaaaagag
ccagactactactatacctggacccatgattctgctctaaccatttctacattgatacct
catttgagatttgatttagccgatatcaataataccaccgaaccgtgggagttatacagc
gccctgtctgacgtactaaaggaatatctctttcgggactatattgaaagtcaagcagag
atacaaataggcaaaaacccttctggtgacttgaaaaaaggtggccttaatgaaccaaaa
ttccatgtcgacggtacccccttcacggggaattggggaaggcctcagagagacggtcca
gcacttcgggccattgcggtgatgatttatgccaacttcctccttgaccgtggatttcct
tcagacgtcagctacgtgcagcaacggatctatgatcccaggcatctcaaatcaccaggg
agagtccttaagaacgatttggaagaggtagcacacggatggtcaaaaggcggctttgat
ctatgggaagaggttgatggacatcacctattcacccttcttgtttcccgtaaagccctg
tacgatggttcgacatttgcgaaacgtctcaacgatgttggagcagcggatcattacctc
gcccaagctcattctatcacgcagaagctttcatcgttttgggattccaaaagaggctat
tggctctcaagcttgagtggtcgcgattttgagcttgtgcagctcaagtcggaatttaac
ttcaccaacgcatatccaagacgagaatggctagattgttcgatacccctgtctatcatc
catgctggctcccacacacttcaacccagccataatttctcttttccgttctctgcaact
gatcccagtgtcctttcgaccatacacctttatatcaagtcttttgatggactttacagt
atcaatgatggcaagccttggtcagatggatgggcgttagggcgttacaaggaagacgta
tatgacggtaagggccaaagtcaagggaatccttggttcatttgcactttttctgttgcg
catagtctgtacctcgcctacaaggagtttcgtgaggcaggtgccattgtgattgccaac
caaaccgttgcgttttgggaagatgtcgtttcgatctcatctaaacctcctaaagttagg
gagggcgatgtttggactgaaggggaagactggcaatttaaggagggaatgaaatgtttg
aaagacgttgcaggcaggttcatggaagttggccagcaagtggcggcagcgaacggggga
agaatgagcgaacaaatagacagagacgatgggcaatgtagaggggcaagggatttgacc
tggtcatacgcaagcttgttggatttgatcagagtgagatcggatttggattga

DBGET integrated database retrieval system