KEGG   Cryptococcus neoformans JEC21: CNE04090Help
Entry
CNE04090          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cne  Cryptococcus neoformans JEC21
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cne03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(1153038..1153133,1153183..1153442,1153494..1153635,1153692..1153820,1153881..1153981,1154042..1154060))
Genome map
AA seq 248 aa AA seqDB search
MSDDDWDADETIAPAAPAVTLPPKVPAKKWADEDAEDNDSDDDWDKSEDEKPQATKVAAV
APAKKKGTLKQKLAEKERLAKEAKEKGVDDDNDLMYTMTEQERRRLAREKEQEADLAVAS
DLMGAVDLGDEGDALKSVLSAHPSTKNDFSELSKNIYTSIIKKHESNPLYAHFVEQLAKD
ISAALTAVQTRKVSSALSVLGNTKQQEEREKASGKKKAASKPKLGAAKVLSKVDTEAYDD
VLGDDDFM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgacgactgggatgctgatgagactatcgcccccgctgcccctgctgtaact
ctccctcccaaggttcccgccaagaagtgggccgatgaggatgccgaagataatgacagt
gacgacgactgggacaaatctgaggatgagaagccacaggcgaccaaggttgctgccgta
gcaccagctaagaagaagggtactctcaagcaaaagcttgccgaaaaggagaggcttgcc
aaggaggctaaggagaagggagtggacgatgacaatgacttgatgtacactatgactgag
caagagaggcggcggttggctagggagaaagagcaagaagcagacttggccgtggcttct
gatctcatgggtgctgtcgacttgggtgacgagggtgatgctctcaagagtgttctttcc
gcccatccctctaccaagaacgacttttccgaactctccaaaaacatctacacttctatc
attaagaagcacgagtccaaccctctttacgctcactttgtcgagcagcttgccaaggac
attagtgccgcgcttaccgctgttcagactaggaaggtgtcttcagctttgagtgtgttg
ggtaacaccaagcaacaggaagagagggaaaaggctagtggaaagaagaaggctgcgtca
aagcccaagctcggcgctgccaaggtattatccaaggttgacactgaggcttacgacgat
gtccttggagatgacgatttcatgtaa

DBGET integrated database retrieval system