KEGG   Cryptococcus neoformans JEC21: CNE04480Help
Entry
CNE04480          CDS       T00243                                 

Definition
sphingosine N-acyltransferase
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cne00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(1255309..1255597,1255662..1255735,1255807..1255866,1255923..1255967,1256027..1256190,1256250..1256277,1256326..1256372,1256426..1256514,1256577..1256781,1256859..1257007,1257107..1257168))
Genome map
AA seq 403 aa AA seqDB search
MSQGHKHLHRRRASSVTVALDQIPLNHNRQSSPESAVKPLPGRRRPTEGDRYRSKGLWSD
IKTGRWLLAPASSFKLSLIAPSLYLLHHLLSTYGIINHSQVPNVFEHFILPSNKLEDGRY
GKSWWDFAFLAHYVIFCTFVRQFMTTRVLRPMARALGVKGQKIVRFTEQGYAIFYFGILG
VYGLYVMRDLPIWWFKTEHFWLEYPHREMTSHLKTYYLLQASYWLQQTIIMIAKIEKPRK
DYKELVAHHIVTLWLIGWSYTVYLTYIGVAIFITMDVSDLFLGLAKCVNYVSEFYSVPLF
AWFTIVWTYMRHYLNIVILHSVWTQFDLIPFPDRTTFDPWNDRWIDWWMKWQIFIPIFLL
QLLNLVWYFLILRILARAVFLNDRKDERSDDEDDVEGDEAKEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaggacataaacatcttcaccgaaggcgggcgtccagcgtgactgtggccctc
gaccagatacctctcaaccacaaccggcaatcttcacccgaatctgcagtgaaaccttta
cccggccgccgacgtccaacagaaggtgatcggtatcgatcgaaaggactgtggagcgat
atcaagactggtagatggctcttggctcccgcctcttccttcaagctttctcttatcgct
ccatccctttatctgctgcaccatctcttaagcacatacggtatcatcaaccactcgcaa
gtgccaaatgtatttgagcactttatcttgccttcaaacaaattggaagatgggaggtac
ggtaaatcatggtgggatttcgctttcctggcacactatgtgatcttttgcacattcgtg
agacagtttatgacgacccgggtcttacggccaatggccagggccctaggagtaaaaggt
caaaagattgtacggttcactgagcaggggtatgccatcttctactttggaatccttgga
gtgtacggtctttatgtcatgcgcgatcttcccatctggtggtttaagacagagcatttc
tggttagaatatcctcaccgggagatgacctcccatctcaaaacttattatctcctccaa
gcgtcatattggctccagcagacgatcattatgattgccaagattgaaaagccgagaaag
gattacaaggagcttgtggcacatcatatcgttactctttggctcattggatggagttac
acagtctatctgacctacattggtgtggcgattttcatcaccatggatgtgtcagaccta
ttccttggtcttgccaaatgcgtcaactatgtttcagaattctattctgtccccttgttc
gcgtggttcaccatcgtctggacgtatatgagacactatctaaacatcgtcatcctccac
tccgtctggacccaatttgacctcatccccttcccggaccgaacgacatttgatccctgg
aacgaccgatggatcgattggtggatgaagtggcagatcttcatcccgatctttttgttg
cagttgctcaacttggtttggtattttctcatcttgaggatcctggcaagagcagtgttt
ttgaatgataggaaggatgaaaggtcggatgatgaagatgatgttgaaggggatgaagca
aaggaagaatga

DBGET integrated database retrieval system