KEGG   Cryptococcus neoformans JEC21: CNE05000Help
Entry
CNE05000          CDS       T00243                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNE05000
   01230 Biosynthesis of amino acids
    CNE05000
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNE05000
   00051 Fructose and mannose metabolism
    CNE05000
   00562 Inositol phosphate metabolism
    CNE05000
Enzymes [BR:cne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CNE05000
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CNE05000
  Exosomal proteins of bladder cancer cells
   CNE05000
  Exosomal proteins of melanoma cells
   CNE05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(join(1392260..1392522,1392588..1392747,1392823..1393132,1393190..1393212))
Genome map
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNGSLESVEKIVRSINDANLDGTNEVVIAPPALYLLKVQSELNAPTQV
SAQNAFTESSGAFTGEIAPQQLKDANVHWVILGHSERRSLFGDTDKLVADKTKAAINAGL
SVIACIGESLEERESDKTMTVVERQLEAIAAAIDVDAWKRIVIAYEPVWAIGTGKVATVS
QAQEVHAAIRSWLSRRASPEIADSTRIIYGGSVNGKNCGKLSAAKDIDGFLVGGASLKPE
FIDICKSGKKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaagttctttgtcggcggtaactttaagatgaacggctctctcgagtctgtc
gagaagattgtccgatccatcaacgacgccaacctcgacggcaccaacgaagtcgtcatc
gccccccctgccttgtacctcctcaaagtccagtccgagctcaacgcgcccacccaagtc
tctgcccagaacgcattcaccgagtcgtctggtgcctttaccggtgagattgcgccccag
cagttgaaggatgcgaatgtgcactgggtgattttggggcattccgagaggaggagtttg
tttggggatacggacaagttggtcgctgacaagaccaaggccgccatcaacgccggcctc
tccgtcattgcctgcatcggcgaatccctcgaagaacgcgaatccgacaagaccatgacc
gtcgttgagcgtcagcttgaggctatcgctgctgctattgacgttgatgcttggaaacgg
atcgtcattgcttacgaacccgtctgggctattggcaccggcaaagtcgccaccgtctcc
caagcgcaagaagtccacgctgccatccgctcctggctctctcgccgcgcttcccccgag
attgccgactcgacccgtatcatttacggcggttccgtcaatggcaagaactgtggcaag
ttgagtgcggcaaaggatattgatgggttccttgtcggcggagccagtttgaaacccgag
tttatcgatatctgcaagtctggcaagaaggcgtaa

DBGET integrated database retrieval system