KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF01300Help
Entry
CNF01300          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  
translation initiation factor 4E
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNF01300
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CNF01300
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNF01300
Translation factors [BR:cne03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CNF01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6:complement(join(386172..386603,386654..386774,386825..387516))
Genome map
AA seq 414 aa AA seqDB search
MTRLPSLKQLSEHLHYTPPTPPSQQPNLHEQSPGSSSSNPLRISTNPVPLQSSSAASHTS
IVMTPTSTGRLKLPASAMMRSLSAGSSGSATGGLAPVTSSPAIAPNLGSVQGQGHSPTSA
HSPTPAQQLAKFVPGGLGDFRPESGPEASTSMSRSASHEVHAEHHREIPSLDEIKKKVNV
SKGEDQHRLDLPNERVTEKEKSKTSVESTGERISISSAKGGKKEHPLQHSWTLYYDSKTY
KPDPSLIASKQGDKILADYEMTLLTIGKFDTVEGFARHFNNVRLPSQLTPSSNYHLFKSG
IRPMWEDPANANGGKWVILFRSSPGTLDIAWANLTMALVGEILDPENQVCGIVGSTRPKV
DRLQVWTRGKDDVEGLNQLGKRIVEVMALEGRDADSMSMEYQVSHKIWASKSQL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccttccttctcttaaacaattatctgaacaccttcactacacaccaccaact
cctccgtctcagcaacctaatctgcatgagcagtcgccaggttcctcaagttccaatccc
cttcgcatctccacaaacccagttcctctccaaagctcatctgccgcttcccacacgtca
attgtcatgacacccacttcaacagggagattgaagttacccgcaagcgctatgatgaga
tcactttctgctggatccagtggttccgccacgggcggcttggcgcctgtcaccagttcg
cctgcaattgcacctaaccttggatctgtccagggccagggtcactctcctacttctgcc
cattctccaacacctgctcaacagttggctaaatttgttccaggtggtttgggcgacttc
cgtccagagtctggtccggaagctagcaccagtatgtcgcgttcggccagtcacgaggtg
catgcagagcaccatcgagagatcccatctctggatgagattaagaaaaaggttaatgtc
agtaagggagaggatcagcacaggttggatttgcccaacgagagagtaacggagaaagag
aagagcaaaacttctgttgagagcactggtgagagaatatctattagctcagccaaaggt
gggaagaaggagcatcccttacagcactcttggacattatactacgattccaaaacatac
aagcctgatccgtccttgattgcttccaaacaaggggataagattcttgccgattacgag
atgacactcttgactatcggcaaatttgacactgttgaaggctttgcacggcattttaac
aatgtccgtctcccaagtcaactcaccccgtcatccaactaccatctcttcaagagcggt
atccggcccatgtgggaagatccagccaacgccaacggtggtaaatgggttattcttttc
cgttcatcacctggaaccctcgatattgcctgggcaaacttgacgatggcgctcgttggt
gagatccttgatccggaaaatcaagtgtgtggaatcgtgggcagtacgcgacctaaggtc
gataggctccaagtatggacaaggggtaaagatgatgtggagggtctaaatcagttaggg
aagaggatcgtggaggttatggctttagaggggagagatgccgatagcatgtctatggag
taccaagtgagtcataaaatatgggcatcaaaaagtcagctctga

DBGET integrated database retrieval system