KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF01300Help
Entry
CNF01300          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03013  RNA transport
Module
cne_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNF01300
Messenger RNA biogenesis [BR:cne03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CNF01300
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CNF01300
Translation factors [BR:cne03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CNF01300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E TMEM126
Motif
Other DBs
NCBI-GeneID: 3258079
NCBI-ProteinID: XP_571561
UniProt: Q5KFL9
Position
6:complement(join(386172..386603,386654..386774,386825..387516))
Genome map
AA seq 414 aa AA seqDB search
MTRLPSLKQLSEHLHYTPPTPPSQQPNLHEQSPGSSSSNPLRISTNPVPLQSSSAASHTS
IVMTPTSTGRLKLPASAMMRSLSAGSSGSATGGLAPVTSSPAIAPNLGSVQGQGHSPTSA
HSPTPAQQLAKFVPGGLGDFRPESGPEASTSMSRSASHEVHAEHHREIPSLDEIKKKVNV
SKGEDQHRLDLPNERVTEKEKSKTSVESTGERISISSAKGGKKEHPLQHSWTLYYDSKTY
KPDPSLIASKQGDKILADYEMTLLTIGKFDTVEGFARHFNNVRLPSQLTPSSNYHLFKSG
IRPMWEDPANANGGKWVILFRSSPGTLDIAWANLTMALVGEILDPENQVCGIVGSTRPKV
DRLQVWTRGKDDVEGLNQLGKRIVEVMALEGRDADSMSMEYQVSHKIWASKSQL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccttccttctcttaaacaattatctgaacaccttcactacacaccaccaact
cctccgtctcagcaacctaatctgcatgagcagtcgccaggttcctcaagttccaatccc
cttcgcatctccacaaacccagttcctctccaaagctcatctgccgcttcccacacgtca
attgtcatgacacccacttcaacagggagattgaagttacccgcaagcgctatgatgaga
tcactttctgctggatccagtggttccgccacgggcggcttggcgcctgtcaccagttcg
cctgcaattgcacctaaccttggatctgtccagggccagggtcactctcctacttctgcc
cattctccaacacctgctcaacagttggctaaatttgttccaggtggtttgggcgacttc
cgtccagagtctggtccggaagctagcaccagtatgtcgcgttcggccagtcacgaggtg
catgcagagcaccatcgagagatcccatctctggatgagattaagaaaaaggttaatgtc
agtaagggagaggatcagcacaggttggatttgcccaacgagagagtaacggagaaagag
aagagcaaaacttctgttgagagcactggtgagagaatatctattagctcagccaaaggt
gggaagaaggagcatcccttacagcactcttggacattatactacgattccaaaacatac
aagcctgatccgtccttgattgcttccaaacaaggggataagattcttgccgattacgag
atgacactcttgactatcggcaaatttgacactgttgaaggctttgcacggcattttaac
aatgtccgtctcccaagtcaactcaccccgtcatccaactaccatctcttcaagagcggt
atccggcccatgtgggaagatccagccaacgccaacggtggtaaatgggttattcttttc
cgttcatcacctggaaccctcgatattgcctgggcaaacttgacgatggcgctcgttggt
gagatccttgatccggaaaatcaagtgtgtggaatcgtgggcagtacgcgacctaaggtc
gataggctccaagtatggacaaggggtaaagatgatgtggagggtctaaatcagttaggg
aagaggatcgtggaggttatggctttagaggggagagatgccgatagcatgtctatggag
taccaagtgagtcataaaatatgggcatcaaaaagtcagctctga

DBGET integrated database retrieval system