KEGG   Cryptococcus neoformans JEC21: CNF02180Help
Entry
CNF02180          CDS       T00243                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNF02180
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNF02180
   00640 Propanoate metabolism
    CNF02180
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CNF02180
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CNF02180
Enzymes [BR:cne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CNF02180
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CNF02180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(633638..633719,633982..634064,634116..634381,634428..634819,634873..639392,639443..639533,639583..639768,639825..640307,640369..640560,640613..640719,640774..640973,641025..641136)
Genome map
AA seq 2237 aa AA seqDB search
MSSATPNGSAVNGQSDIYDHSKVAQFIGANSVESAPSGRVTDFVKAHNGHTVITKVLIAN
NGIAAVKEIRSIRKWSYETFGSDRQIEFTVMATPEDLRINAEYIRMADRYVEVPGGSNNN
NYANVDFIVDVAERAGVHAVWAGWGHASENPRLPETLAKSKIIFIGPPGSAMRSLGDKIS
STIVAQHAKVPCMPWSGTGISDTILSPQGFVTVPDKAYDDACVHSWEEGLERAEKIGFPI
MIKASEGGGGKGIRKVEDGEKFKNSFQAVAGEVPGSPIFIMKLAGSARHLEVQLIADQYG
NAISLFGRDCSVQRRHQKIIEEAPVTIAKPETFEEMEKAAVRLAKLVGYVSAGTVEYLYS
HSDDSFYFLELNPRLQVEHPTTEMVSGCNIPAVQLQIAMGIPLHRIRDIRTLYGMDPHGI
TEIDFDGSKPESVNTQRKPTPKGHVIACRITGENPDAGFKPSSGNLTELNFRSNSNVWGY
FSVSSAGGLHEYADSQFGHIFAYGMERSEARKSMVVALKELSIRGEFRTTVEYLIKLLEK
PEFENNTLTTQWLDGLIAEGMTSERPDPVVAVVCGAVVKAYIAYEASLAKYKSVLDKGQV
PPKDSLQTFFKSEFIYENVRYSFAMAKSSAYSFTLYLNGGRIFVGCRGLSDGGLLISLSG
ATHTVYFREEVGAMVLSVDSKTTLIEDEQDPSQLRSPSPGKLVRYLIDSGDHVDAGDAYA
EIEVMKMIMSVTASESGIAQFMKQPGQTLASGELLGILTLDDPTKVKFAKPFEGILPTFE
LKNGRYGTKPHQRLREHLEVLYDNLSGYDNSASVLSSLRIVETALRDADLPYSNAQGVMS
TLSGRIPQKLEDEIRSILDSCRAGRFEFPSRKLQHTIDVFVEENVLPKERPQVIAAISPL
KVLIDAFAHGLKVHEWQTWADLLSFFADVEEPFADTTRTQENVILKLRDDCKDLDQVVNL
VLSHSKIALKTKLVLALLDVIKSESPRASMTPESRVNDALSRLAALDSRPTAKVALKAKE
VMIVGSLPSYEERLGQLEKLLSAAVTTSYYGQQGSGHRLPSADVLKEVTDSRYTVFDVLT
TFFDHDDPWVALAALEVYVRRAYRVYNVLHLDYEAGEKGGEPHIITWRFKLGGHQSEPAT
PRVDSTKDFTRIASMSDLSYVVTTKTEPVRFGLMTSYNDLASLEQSFAKLLSIYPAFSHA
EHIEKFGKDARHPHVMNVALRLFNGEQMSDIELNERFHALANQYAAEINGKGIRRISFVI
CRKDQYPAYVTLRESVEGYWKEEEAIRDIEPALAYQLELGRLSNFKITPQPSSNRQIHVY
HAVGRENTSDVRFFVRALLRPGRFQGNMQVKEYLISETDRLVGDILDTLEVVSSQHRQAD
CNHIMVNCVYNLNVTFDDIQEALAGFIERHGKRLWRLRVTQAEIRVVIEDEEGNVLPIRS
FIENVSGFVVKYEAYQEIDNDKGKSILKSIGENGQFHLQPVNFPYSTKESLQPRRYQAHV
IGTTYVYDFPDLFRQATDKAWHNLQTYLPNIKIPSDLLTATELIFDEHGELQEVNRAPGL
NTCGMVAWVYTLKTPEYPQGRRVVVISNDITYQIGSFGPIEDEFFYKATQYARKHGLPRI
YLSANSGARIGLAEEVMALFDVAWREAGKPEKGFDYLYLTPANLDKLNDMGPGSVITDEI
EVDGERRHKIVSVIGLKDGLGVECLRGSGLIAGETSRAYDDIFTISMVTARSVGIGAYLV
RLGQRVVQVEGQPIILTGAQAINKVLGKEVYTSNIQLGGPQIMYKNGISHLTAGSDLDGA
LQIINYLMFIPEQRGRAIPILPTGDHWDRAVEWKPTKAAYDPRNFLSGCSEDIDGVQSWK
SGILDNGSFFETMGGWAQTIVTGRGRISGIPVAVIAAETRSIERVDPADPANENSQESRV
SLAGTVWFPDSSRKTATAIEDANREGLPLVIFANFRGFSGGMSDMAQAILKEGAKIVDGL
SSYKHPVIVYLVPNGELRGGAWVVLDPSINPEHMTMFVDNESRGGVLEPEGIVEVKYRKP
KVQATMARLDEEYARLKKEVENPNASPEEKTAATAKLEAREKHLGPAYQSIALEFADLHD
RSGRMKAKADCIPCDWENSRRAIYWSLRRKLSETRILKKLENANPRLTYPERKELLQQFI
PIELSSDSEVAAYIEKSGEAIESFIQGVRDEWCSDTLVSWAGTNQEGVMSGFKRILEGLS
AEQKAQVLAELGMQGQA
NT seq 6714 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggctacccccaacgggagcgccgtgaatggtcaatcagacatatacgaccat
tccaaagttgcccagtttatcggcgccaactctgtcgagtccgcaccttctggccgggtg
accgacttcgtcaaggctcacaacggtcacactgttatcactaaggttttgatcgccaac
aacggtattgccgctgttaaggaaattaggtccatcagaaaatggtcttacgaaaccttt
ggctctgatcgtcaaattgaattcactgtcatggcgaccccggaagatttgcgaatcaac
gccgaatatatccgcatggcggaccgatacgttgaggtcccaggtggaagcaacaacaac
aactatgccaacgttgatttcattgtagatgttgcggagcgagccggtgtccatgccgtc
tgggctggttggggtcacgcttctgaaaaccctcggcttcctgaaactctcgccaaatcg
aagatcatctttatcggtcctcctggatctgctatgcgatccctcggtgacaagatttca
tctaccattgttgctcagcacgcgaaagttccctgtatgccatggtccggtaccggcatt
tccgacacaatactttccccccaaggcttcgtgacggttcctgacaaggcgtacgacgat
gcttgcgtccacagctgggaggagggtcttgagagggctgagaagattggattcccgatc
atgatcaaggctagtgagggcggtggtggtaagggcatcagaaaggttgaggatggagag
aagttcaagaattcgttccaggctgttgccggcgaagtacctggatcaccgatcttcatt
atgaagcttgccggatcagctcgtcacttggaagtccaacttatcgccgaccaatacggt
aatgccatctcccttttcggtcgagactgttccgttcagcgtcgacaccaaaagatcatc
gaagaagcgcctgtcactattgccaagccggagacatttgaagagatggagaaggctgca
gttcgactcgccaaattggtcggctacgtctctgctggtacggtcgagtacctttactcc
cactctgatgatagtttctacttcctcgagttgaaccctcgtcttcaagtggagcaccct
accactgagatggtcagtggctgtaacatcccagccgttcaactccaaattgcgatgggt
atccctctacaccgaatccgagacatccgtactctttacggtatggaccctcacggcatc
acagaaattgatttcgatggtagtaagcctgaatccgtcaacactcagcgtaagcctact
cctaagggccatgtcattgcttgtcgtatcactggtgaaaaccccgacgctgggttcaag
ccctcttccggtaaccttaccgagctcaacttccgttccaactctaacgtctggggttac
ttttccgtgtcctctgctggtggtctccatgaatatgcggactctcaattcgggcacatt
tttgcctacggcatggagcggagtgaggcccggaaatcgatggtcgtcgcgctcaaggag
ttgagcatccggggtgaatttcgaacgactgttgaatacttgatcaagttgttggagaag
ccagaatttgaaaacaacacccttaccacccaatggctggatggccttatcgcggagggt
atgacgtctgaacgcccggaccctgttgtcgctgtcgtttgtggtgctgtagttaaggct
tatattgcttacgaagcgtcacttgctaagtacaaatcggtccttgacaagggtcaagtt
cctcctaaggactctctccagacgttcttcaagagtgaattcatttatgagaatgtgcga
tattcatttgccatggccaagtcttctgcctactctttcactctctacctcaacggcggt
cgtatctttgttgggtgccgaggtctcagcgatggtggtcttctgatctccctgagcggc
gctactcacacggtttacttccgagaagaagtgggcgccatggtcctttccgtggactcc
aagaccacacttattgaagatgagcaggacccaagtcagctccgaagcccttctcccggt
aaacttgtacggtacctcattgactctggtgatcatgtcgatgcgggcgatgcctatgcg
gagatcgaagtcatgaagatgattatgtcagtgactgccagcgagagcggtatcgctcaa
ttcatgaagcaacctggccagaccctggcctccggcgagttgctcggtatcttgaccctc
gacgatcctacgaaggtcaaattcgctaagcctttcgagggtattcttccaacgttcgaa
ttaaagaacggtcgatacggcacaaagcctcatcaacgtttgcgcgagcatcttgaagtt
ctttacgataacctttccggctacgataacagtgcctctgtcctttcttcgcttcgcatc
gtcgagactgcccttcgtgacgccgatcttccgtactctaacgcccagggcgtcatgtcc
accctcagtggtcgtatccctcaaaagctcgaggacgaaatccgcagcattttggattct
tgccgtgccggacggtttgagttccctagtcgcaagcttcaacataccatcgatgtgttt
gttgaagaaaatgtcttgcccaaagagcgtcctcaagttattgcagccatttcccctctc
aaggttctgattgatgccttcgctcatggacttaaagttcacgagtggcagacttgggcg
gatctgctaagcttctttgccgatgttgaagagcctttcgccgacaccacccgtactcaa
gagaacgtcattctcaagcttcgagatgattgcaaagaccttgatcaggtcgttaatctc
gtcctttcccacagtaagattgctttaaagaccaagttggtccttgctttgcttgatgtt
atcaagtccgaatcacctcgtgcctccatgactcccgaaagccgtgtcaatgatgctctt
agtcgacttgccgctctcgacagtcgacccaccgccaaggttgcactcaaggccaaggag
gtgatgatcgtcggatctctcccgagttatgaggagagactcggccagttggagaaactt
ctcagtgctgctgtcactaccagctattacggccagcaaggctcaggccatcgattgcct
tcggctgatgttctcaaggaggtcaccgactctcgttacaccgtcttcgatgtgctcacc
actttcttcgatcatgatgatccttgggttgcccttgctgcccttgaagtgtacgtccga
cgagcatatcgggtgtacaacgtcttgcaccttgactacgaagcaggtgaaaaaggtggt
gagcctcatatcatcacctggcgattcaagctcggcggtcatcaaagcgagcccgccacg
cctcgcgttgactctaccaaggactttacccgtatcgcaagcatgtctgacctcagctat
gttgtcaccaccaagactgagccggttcgatttggtctcatgacttcgtacaatgatttg
gcttctcttgagcaaagttttgctaagctcctctccatataccccgccttcagccatgct
gaacacatcgaaaaattcggaaaggacgcccgccatcctcatgttatgaatgtcgcccta
cgtttgtttaatggcgaacagatgtctgacattgagctcaacgagcgattccacgcgctt
gcaaaccagtatgctgcggagattaatggaaaaggtattcgacgaatcagcttcgtaatc
tgccgcaaggaccaatacccagcctatgtgactcttcgcgaatctgttgagggttattgg
aaggaggaagaagctatcagagacatcgaacctgctcttgcttatcagctggaactcgga
cgattgtccaacttcaagatcactcctcaaccttcttctaaccgacaaattcacgtttac
catgctgttggccgtgagaacacctctgatgttcgcttctttgtgcgagcgcttcttcga
ccgggtcgtttccaaggaaacatgcaggtcaaggagtaccttatctctgagacagaccgg
ctcgtaggtgacatccttgacacccttgaagttgtcagctcccagcaccgacaagccgac
tgtaaccacatcatggttaactgtgtctacaacctcaatgtcacctttgacgacatccag
gaggcgttggctggtttcattgagcgtcacggcaagaggctgtggaggttgcgtgtgact
caggcggagatcagagtggttattgaagacgaggaagggaacgttttgcccatccgatcg
ttcattgagaatgtctcaggatttgtagtcaagtatgaggcttatcaggaaatcgataac
gacaagggcaagtccatccttaaatccattggcgagaacggtcaattccatctccagcct
gtcaacttcccttactcaacaaaggagtctctccagcctcgtcgataccaagctcatgtg
atcggcaccacttatgtctatgacttcccagatcttttccgacaggcgactgacaaagcg
tggcataatctccagacatatctgcccaacatcaagattccatcagatttgcttactgct
accgaattgatctttgacgagcatggtgagttgcaggaagtgaatcgtgctcctggtctc
aacacctgcggtatggtcgcctgggtgtacaccctcaagacacccgagtatccccaaggc
cgtcgggtcgtcgtcatctctaacgacatcacctatcagattggttctttcggtccaatt
gaagatgaattcttctacaaggcgacccagtatgcccgtaaacacggtcttcctcgaatt
tacctttccgcaaattctggtgcccgtattggcctggctgaggaggtcatggctcttttc
gatgttgcgtggcgtgaagctggcaagcctgaaaaaggttttgactatctctacctcaca
cccgccaaccttgataagcttaatgacatgggacccggcagtgtgatcactgacgaaatt
gaggtcgatggagagaggaggcataagattgtgtccgttatcggtctcaaagacggtttg
ggtgtcgaatgtttacgaggctccggtttgattgcgggtgaaacctccagggcatacgat
gacatctttactatttctatggtaactgcacgatcggttggtattggtgcctaccttgtc
agattgggacagcgtgttgttcaagtagaaggtcaaccgattatcttaactggtgctcaa
gctatcaacaaagttttgggtaaggaggtgtacacgagtaacatccagttgggtggtcct
cagatcatgtacaaaaacggtatctctcacttgactgcgggcagcgacctggatggtgct
ctacaaatcatcaactatttgatgttcattcccgaacaacgtggtcgagctatccctatc
ctgcctactggtgaccattgggaccgagccgttgagtggaagcccaccaaggccgcttac
gaccctcgaaacttcttgtctggttgcagtgaggacattgatggtgtgcagagctggaaa
tctggtatcttagataacggtagtttctttgagacgatgggcggctgggctcaaaccatt
gtgactggtcgaggaagaatcagtggtatacccgtggcagtcattgccgctgagactcga
tccatcgagcgcgtcgaccctgccgaccccgcgaatgagaactctcaagaaagtcgcgtg
tcccttgctggtaccgtttggttccccgacagctccagaaagactgctactgccatcgaa
gatgccaaccgagagggcctcccacttgttatctttgccaacttccgaggtttctccggc
ggtatgtccgacatggcgcaagccattctcaaggagggtgcaaagatcgtcgacggtcta
agtagctacaagcaccctgtcattgtctatctcgtacccaatggggaattgcgaggtggt
gcgtgggtagtcttggacccatccatcaaccctgaacacatgaccatgtttgtcgacaat
gagtctaggggtggtgtcttggaacctgagggtatcgtggaggttaaatatcgtaagcca
aaggtccaggctaccatggcacgattggatgaggaatacgcccgactcaagaaggaagtt
gagaaccccaacgcttctcctgaagagaagactgcggcgacagctaagcttgaagctcgt
gagaaacatctcggccccgcttaccaatccatcgctcttgagtttgccgatctccacgat
cgaagtggtcgaatgaaggccaaagccgactgtattccctgtgactgggagaactctcgt
cgtgcgatctactggtctttgagaagaaagttaagcgagactcgtattctcaagaaactt
gaaaacgccaaccctcgtcttacttatcctgagcgaaaagagcttctccagcagttcatt
cccatcgagctttccagcgacagcgaggtggctgcgtacatcgaaaaatctggagaagct
attgagtcattcatccagggtgtgcgcgacgagtggtgttccgacactttggtttcctgg
gccggaaccaaccaggagggagtcatgtctggtttcaagagaatcttagaaggtctctca
gcggagcagaaggcacaggtgcttgccgaacttgggatgcaaggtcaagcttaa

DBGET integrated database retrieval system