KEGG   Cryptococcus neoformans JEC21: CNF02180Help
Entry
CNF02180          CDS       T00243                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cne01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cne00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cne00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:cne00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(633638..633719,633982..634064,634116..634381,634428..634819,634873..639392,639443..639533,639583..639768,639825..640307,640369..640560,640613..640719,640774..640973,641025..641136)
Genome map
AA seq 2237 aa AA seqDB search
MSSATPNGSAVNGQSDIYDHSKVAQFIGANSVESAPSGRVTDFVKAHNGHTVITKVLIAN
NGIAAVKEIRSIRKWSYETFGSDRQIEFTVMATPEDLRINAEYIRMADRYVEVPGGSNNN
NYANVDFIVDVAERAGVHAVWAGWGHASENPRLPETLAKSKIIFIGPPGSAMRSLGDKIS
STIVAQHAKVPCMPWSGTGISDTILSPQGFVTVPDKAYDDACVHSWEEGLERAEKIGFPI
MIKASEGGGGKGIRKVEDGEKFKNSFQAVAGEVPGSPIFIMKLAGSARHLEVQLIADQYG
NAISLFGRDCSVQRRHQKIIEEAPVTIAKPETFEEMEKAAVRLAKLVGYVSAGTVEYLYS
HSDDSFYFLELNPRLQVEHPTTEMVSGCNIPAVQLQIAMGIPLHRIRDIRTLYGMDPHGI
TEIDFDGSKPESVNTQRKPTPKGHVIACRITGENPDAGFKPSSGNLTELNFRSNSNVWGY
FSVSSAGGLHEYADSQFGHIFAYGMERSEARKSMVVALKELSIRGEFRTTVEYLIKLLEK
PEFENNTLTTQWLDGLIAEGMTSERPDPVVAVVCGAVVKAYIAYEASLAKYKSVLDKGQV
PPKDSLQTFFKSEFIYENVRYSFAMAKSSAYSFTLYLNGGRIFVGCRGLSDGGLLISLSG
ATHTVYFREEVGAMVLSVDSKTTLIEDEQDPSQLRSPSPGKLVRYLIDSGDHVDAGDAYA
EIEVMKMIMSVTASESGIAQFMKQPGQTLASGELLGILTLDDPTKVKFAKPFEGILPTFE
LKNGRYGTKPHQRLREHLEVLYDNLSGYDNSASVLSSLRIVETALRDADLPYSNAQGVMS
TLSGRIPQKLEDEIRSILDSCRAGRFEFPSRKLQHTIDVFVEENVLPKERPQVIAAISPL
KVLIDAFAHGLKVHEWQTWADLLSFFADVEEPFADTTRTQENVILKLRDDCKDLDQVVNL
VLSHSKIALKTKLVLALLDVIKSESPRASMTPESRVNDALSRLAALDSRPTAKVALKAKE
VMIVGSLPSYEERLGQLEKLLSAAVTTSYYGQQGSGHRLPSADVLKEVTDSRYTVFDVLT
TFFDHDDPWVALAALEVYVRRAYRVYNVLHLDYEAGEKGGEPHIITWRFKLGGHQSEPAT
PRVDSTKDFTRIASMSDLSYVVTTKTEPVRFGLMTSYNDLASLEQSFAKLLSIYPAFSHA
EHIEKFGKDARHPHVMNVALRLFNGEQMSDIELNERFHALANQYAAEINGKGIRRISFVI
CRKDQYPAYVTLRESVEGYWKEEEAIRDIEPALAYQLELGRLSNFKITPQPSSNRQIHVY
HAVGRENTSDVRFFVRALLRPGRFQGNMQVKEYLISETDRLVGDILDTLEVVSSQHRQAD
CNHIMVNCVYNLNVTFDDIQEALAGFIERHGKRLWRLRVTQAEIRVVIEDEEGNVLPIRS
FIENVSGFVVKYEAYQEIDNDKGKSILKSIGENGQFHLQPVNFPYSTKESLQPRRYQAHV
IGTTYVYDFPDLFRQATDKAWHNLQTYLPNIKIPSDLLTATELIFDEHGELQEVNRAPGL
NTCGMVAWVYTLKTPEYPQGRRVVVISNDITYQIGSFGPIEDEFFYKATQYARKHGLPRI
YLSANSGARIGLAEEVMALFDVAWREAGKPEKGFDYLYLTPANLDKLNDMGPGSVITDEI
EVDGERRHKIVSVIGLKDGLGVECLRGSGLIAGETSRAYDDIFTISMVTARSVGIGAYLV
RLGQRVVQVEGQPIILTGAQAINKVLGKEVYTSNIQLGGPQIMYKNGISHLTAGSDLDGA
LQIINYLMFIPEQRGRAIPILPTGDHWDRAVEWKPTKAAYDPRNFLSGCSEDIDGVQSWK
SGILDNGSFFETMGGWAQTIVTGRGRISGIPVAVIAAETRSIERVDPADPANENSQESRV
SLAGTVWFPDSSRKTATAIEDANREGLPLVIFANFRGFSGGMSDMAQAILKEGAKIVDGL
SSYKHPVIVYLVPNGELRGGAWVVLDPSINPEHMTMFVDNESRGGVLEPEGIVEVKYRKP
KVQATMARLDEEYARLKKEVENPNASPEEKTAATAKLEAREKHLGPAYQSIALEFADLHD
RSGRMKAKADCIPCDWENSRRAIYWSLRRKLSETRILKKLENANPRLTYPERKELLQQFI
PIELSSDSEVAAYIEKSGEAIESFIQGVRDEWCSDTLVSWAGTNQEGVMSGFKRILEGLS
AEQKAQVLAELGMQGQA
NT seq 6714 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcggctacccccaacgggagcgccgtgaatggtcaatcagacatatacgaccat
tccaaagttgcccagtttatcggcgccaactctgtcgagtccgcaccttctggccgggtg
accgacttcgtcaaggctcacaacggtcacactgttatcactaaggttttgatcgccaac
aacggtattgccgctgttaaggaaattaggtccatcagaaaatggtcttacgaaaccttt
ggctctgatcgtcaaattgaattcactgtcatggcgaccccggaagatttgcgaatcaac
gccgaatatatccgcatggcggaccgatacgttgaggtcccaggtggaagcaacaacaac
aactatgccaacgttgatttcattgtagatgttgcggagcgagccggtgtccatgccgtc
tgggctggttggggtcacgcttctgaaaaccctcggcttcctgaaactctcgccaaatcg
aagatcatctttatcggtcctcctggatctgctatgcgatccctcggtgacaagatttca
tctaccattgttgctcagcacgcgaaagttccctgtatgccatggtccggtaccggcatt
tccgacacaatactttccccccaaggcttcgtgacggttcctgacaaggcgtacgacgat
gcttgcgtccacagctgggaggagggtcttgagagggctgagaagattggattcccgatc
atgatcaaggctagtgagggcggtggtggtaagggcatcagaaaggttgaggatggagag
aagttcaagaattcgttccaggctgttgccggcgaagtacctggatcaccgatcttcatt
atgaagcttgccggatcagctcgtcacttggaagtccaacttatcgccgaccaatacggt
aatgccatctcccttttcggtcgagactgttccgttcagcgtcgacaccaaaagatcatc
gaagaagcgcctgtcactattgccaagccggagacatttgaagagatggagaaggctgca
gttcgactcgccaaattggtcggctacgtctctgctggtacggtcgagtacctttactcc
cactctgatgatagtttctacttcctcgagttgaaccctcgtcttcaagtggagcaccct
accactgagatggtcagtggctgtaacatcccagccgttcaactccaaattgcgatgggt
atccctctacaccgaatccgagacatccgtactctttacggtatggaccctcacggcatc
acagaaattgatttcgatggtagtaagcctgaatccgtcaacactcagcgtaagcctact
cctaagggccatgtcattgcttgtcgtatcactggtgaaaaccccgacgctgggttcaag
ccctcttccggtaaccttaccgagctcaacttccgttccaactctaacgtctggggttac
ttttccgtgtcctctgctggtggtctccatgaatatgcggactctcaattcgggcacatt
tttgcctacggcatggagcggagtgaggcccggaaatcgatggtcgtcgcgctcaaggag
ttgagcatccggggtgaatttcgaacgactgttgaatacttgatcaagttgttggagaag
ccagaatttgaaaacaacacccttaccacccaatggctggatggccttatcgcggagggt
atgacgtctgaacgcccggaccctgttgtcgctgtcgtttgtggtgctgtagttaaggct
tatattgcttacgaagcgtcacttgctaagtacaaatcggtccttgacaagggtcaagtt
cctcctaaggactctctccagacgttcttcaagagtgaattcatttatgagaatgtgcga
tattcatttgccatggccaagtcttctgcctactctttcactctctacctcaacggcggt
cgtatctttgttgggtgccgaggtctcagcgatggtggtcttctgatctccctgagcggc
gctactcacacggtttacttccgagaagaagtgggcgccatggtcctttccgtggactcc
aagaccacacttattgaagatgagcaggacccaagtcagctccgaagcccttctcccggt
aaacttgtacggtacctcattgactctggtgatcatgtcgatgcgggcgatgcctatgcg
gagatcgaagtcatgaagatgattatgtcagtgactgccagcgagagcggtatcgctcaa
ttcatgaagcaacctggccagaccctggcctccggcgagttgctcggtatcttgaccctc
gacgatcctacgaaggtcaaattcgctaagcctttcgagggtattcttccaacgttcgaa
ttaaagaacggtcgatacggcacaaagcctcatcaacgtttgcgcgagcatcttgaagtt
ctttacgataacctttccggctacgataacagtgcctctgtcctttcttcgcttcgcatc
gtcgagactgcccttcgtgacgccgatcttccgtactctaacgcccagggcgtcatgtcc
accctcagtggtcgtatccctcaaaagctcgaggacgaaatccgcagcattttggattct
tgccgtgccggacggtttgagttccctagtcgcaagcttcaacataccatcgatgtgttt
gttgaagaaaatgtcttgcccaaagagcgtcctcaagttattgcagccatttcccctctc
aaggttctgattgatgccttcgctcatggacttaaagttcacgagtggcagacttgggcg
gatctgctaagcttctttgccgatgttgaagagcctttcgccgacaccacccgtactcaa
gagaacgtcattctcaagcttcgagatgattgcaaagaccttgatcaggtcgttaatctc
gtcctttcccacagtaagattgctttaaagaccaagttggtccttgctttgcttgatgtt
atcaagtccgaatcacctcgtgcctccatgactcccgaaagccgtgtcaatgatgctctt
agtcgacttgccgctctcgacagtcgacccaccgccaaggttgcactcaaggccaaggag
gtgatgatcgtcggatctctcccgagttatgaggagagactcggccagttggagaaactt
ctcagtgctgctgtcactaccagctattacggccagcaaggctcaggccatcgattgcct
tcggctgatgttctcaaggaggtcaccgactctcgttacaccgtcttcgatgtgctcacc
actttcttcgatcatgatgatccttgggttgcccttgctgcccttgaagtgtacgtccga
cgagcatatcgggtgtacaacgtcttgcaccttgactacgaagcaggtgaaaaaggtggt
gagcctcatatcatcacctggcgattcaagctcggcggtcatcaaagcgagcccgccacg
cctcgcgttgactctaccaaggactttacccgtatcgcaagcatgtctgacctcagctat
gttgtcaccaccaagactgagccggttcgatttggtctcatgacttcgtacaatgatttg
gcttctcttgagcaaagttttgctaagctcctctccatataccccgccttcagccatgct
gaacacatcgaaaaattcggaaaggacgcccgccatcctcatgttatgaatgtcgcccta
cgtttgtttaatggcgaacagatgtctgacattgagctcaacgagcgattccacgcgctt
gcaaaccagtatgctgcggagattaatggaaaaggtattcgacgaatcagcttcgtaatc
tgccgcaaggaccaatacccagcctatgtgactcttcgcgaatctgttgagggttattgg
aaggaggaagaagctatcagagacatcgaacctgctcttgcttatcagctggaactcgga
cgattgtccaacttcaagatcactcctcaaccttcttctaaccgacaaattcacgtttac
catgctgttggccgtgagaacacctctgatgttcgcttctttgtgcgagcgcttcttcga
ccgggtcgtttccaaggaaacatgcaggtcaaggagtaccttatctctgagacagaccgg
ctcgtaggtgacatccttgacacccttgaagttgtcagctcccagcaccgacaagccgac
tgtaaccacatcatggttaactgtgtctacaacctcaatgtcacctttgacgacatccag
gaggcgttggctggtttcattgagcgtcacggcaagaggctgtggaggttgcgtgtgact
caggcggagatcagagtggttattgaagacgaggaagggaacgttttgcccatccgatcg
ttcattgagaatgtctcaggatttgtagtcaagtatgaggcttatcaggaaatcgataac
gacaagggcaagtccatccttaaatccattggcgagaacggtcaattccatctccagcct
gtcaacttcccttactcaacaaaggagtctctccagcctcgtcgataccaagctcatgtg
atcggcaccacttatgtctatgacttcccagatcttttccgacaggcgactgacaaagcg
tggcataatctccagacatatctgcccaacatcaagattccatcagatttgcttactgct
accgaattgatctttgacgagcatggtgagttgcaggaagtgaatcgtgctcctggtctc
aacacctgcggtatggtcgcctgggtgtacaccctcaagacacccgagtatccccaaggc
cgtcgggtcgtcgtcatctctaacgacatcacctatcagattggttctttcggtccaatt
gaagatgaattcttctacaaggcgacccagtatgcccgtaaacacggtcttcctcgaatt
tacctttccgcaaattctggtgcccgtattggcctggctgaggaggtcatggctcttttc
gatgttgcgtggcgtgaagctggcaagcctgaaaaaggttttgactatctctacctcaca
cccgccaaccttgataagcttaatgacatgggacccggcagtgtgatcactgacgaaatt
gaggtcgatggagagaggaggcataagattgtgtccgttatcggtctcaaagacggtttg
ggtgtcgaatgtttacgaggctccggtttgattgcgggtgaaacctccagggcatacgat
gacatctttactatttctatggtaactgcacgatcggttggtattggtgcctaccttgtc
agattgggacagcgtgttgttcaagtagaaggtcaaccgattatcttaactggtgctcaa
gctatcaacaaagttttgggtaaggaggtgtacacgagtaacatccagttgggtggtcct
cagatcatgtacaaaaacggtatctctcacttgactgcgggcagcgacctggatggtgct
ctacaaatcatcaactatttgatgttcattcccgaacaacgtggtcgagctatccctatc
ctgcctactggtgaccattgggaccgagccgttgagtggaagcccaccaaggccgcttac
gaccctcgaaacttcttgtctggttgcagtgaggacattgatggtgtgcagagctggaaa
tctggtatcttagataacggtagtttctttgagacgatgggcggctgggctcaaaccatt
gtgactggtcgaggaagaatcagtggtatacccgtggcagtcattgccgctgagactcga
tccatcgagcgcgtcgaccctgccgaccccgcgaatgagaactctcaagaaagtcgcgtg
tcccttgctggtaccgtttggttccccgacagctccagaaagactgctactgccatcgaa
gatgccaaccgagagggcctcccacttgttatctttgccaacttccgaggtttctccggc
ggtatgtccgacatggcgcaagccattctcaaggagggtgcaaagatcgtcgacggtcta
agtagctacaagcaccctgtcattgtctatctcgtacccaatggggaattgcgaggtggt
gcgtgggtagtcttggacccatccatcaaccctgaacacatgaccatgtttgtcgacaat
gagtctaggggtggtgtcttggaacctgagggtatcgtggaggttaaatatcgtaagcca
aaggtccaggctaccatggcacgattggatgaggaatacgcccgactcaagaaggaagtt
gagaaccccaacgcttctcctgaagagaagactgcggcgacagctaagcttgaagctcgt
gagaaacatctcggccccgcttaccaatccatcgctcttgagtttgccgatctccacgat
cgaagtggtcgaatgaaggccaaagccgactgtattccctgtgactgggagaactctcgt
cgtgcgatctactggtctttgagaagaaagttaagcgagactcgtattctcaagaaactt
gaaaacgccaaccctcgtcttacttatcctgagcgaaaagagcttctccagcagttcatt
cccatcgagctttccagcgacagcgaggtggctgcgtacatcgaaaaatctggagaagct
attgagtcattcatccagggtgtgcgcgacgagtggtgttccgacactttggtttcctgg
gccggaaccaaccaggagggagtcatgtctggtttcaagagaatcttagaaggtctctca
gcggagcagaaggcacaggtgcttgccgaacttgggatgcaaggtcaagcttaa

DBGET integrated database retrieval system