KEGG   Cryptococcus neoformans JEC21: CNF02430Help
Entry
CNF02430          CDS       T00243                                 

Definition
acyl-protein thioesterase-1
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNF02430
Enzymes [BR:cne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CNF02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(711156..711331,711380..711455,711508..711884,711935..711950,712007..712078))
Genome map
AA seq 238 aa AA seqDB search
MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPVS
LNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLGGFS
QGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDPVVDYR
FGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWLMEALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccacatctttgaaacacctaaagatttcgcccaaggaggcccatactgctactgtc
atctttcttcacgggttgggcgatagtggccatgggtggcttcctgttgctaagatgctt
tggagctcgttccctaatgtgaaatggatacttccacatgcccctacaatccccgtctcc
ttaaaccacggcatggctatgccatcttggttcgacattcgtcaccttgataaattggat
aactcggagaacgacgatgagcaggggatgctcgaaacgctaaagtcagttgacgagctt
atccaagccgaggtggatagtgggatccctgaaaataggatcgttctcggtggtttttcc
cagggcggcgcgatcagtgttctaaacatgctgacaacaaagaggaagctggctggagtg
gtggcgttgagcacttgggtccctctcaaccacaagattgtacaaatgatgtctgagcat
gccaaggatattccagtgttctggggccacggaacgaatgacccagtggtcgattaccgc
tttggacaacgatcagttgattttcttgtacaaaaatgtggctacaagctgctttctcag
ggcacaacctttgctcgtcctggtatccgttttgaatcctacccaggaatgccccattct
tcctgtcctcaggagattgaagatctcaagtcgtggttaatggaggcgctcaagtaa

DBGET integrated database retrieval system