KEGG   Cryptococcus neoformans JEC21: CNF02430Help
Entry
CNF02430          CDS       T00243                                 

Definition
acyl-protein thioesterase-1
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cne00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(711156..711331,711380..711455,711508..711884,711935..711950,712007..712078))
Genome map
AA seq 238 aa AA seqDB search
MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPVS
LNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLGGFS
QGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDPVVDYR
FGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWLMEALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccacatctttgaaacacctaaagatttcgcccaaggaggcccatactgctactgtc
atctttcttcacgggttgggcgatagtggccatgggtggcttcctgttgctaagatgctt
tggagctcgttccctaatgtgaaatggatacttccacatgcccctacaatccccgtctcc
ttaaaccacggcatggctatgccatcttggttcgacattcgtcaccttgataaattggat
aactcggagaacgacgatgagcaggggatgctcgaaacgctaaagtcagttgacgagctt
atccaagccgaggtggatagtgggatccctgaaaataggatcgttctcggtggtttttcc
cagggcggcgcgatcagtgttctaaacatgctgacaacaaagaggaagctggctggagtg
gtggcgttgagcacttgggtccctctcaaccacaagattgtacaaatgatgtctgagcat
gccaaggatattccagtgttctggggccacggaacgaatgacccagtggtcgattaccgc
tttggacaacgatcagttgattttcttgtacaaaaatgtggctacaagctgctttctcag
ggcacaacctttgctcgtcctggtatccgttttgaatcctacccaggaatgccccattct
tcctgtcctcaggagattgaagatctcaagtcgtggttaatggaggcgctcaagtaa

DBGET integrated database retrieval system