KEGG   Cryptococcus neoformans JEC21: CNF02480Help
Entry
CNF02480          CDS       T00243                                 

Definition
ketol-acid reductoisomerase
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
cne  Cryptococcus neoformans JEC21
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CNF02480
   01230 Biosynthesis of amino acids
    CNF02480
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CNF02480
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CNF02480
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase
     CNF02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(721665..721799,721857..721945,722054..722375,722431..722676,722738..722949,722999..723173,723227..723253)
Genome map
AA seq 401 aa AA seqDB search
MSFSRASSNALKQALKSTASRQVARRSYSLLSGAAPRAAMATRLGATRGIKTLDFAGTKE
VVYERADWPLDKLQDYFKNDTLAMIGYGSQGHGQSLNARDNGLKVIVGVRKGGESWKQAQ
EDGWVPGETLFDIPEAINKGTIIMNLLSDAAQSQTWNEIAPLITKGKTLYFAHGFSVVYK
EDTHVIPPKDVDVILVAPKGSGRTVRTLFLEGRGINSSIAVYQDVTGHAKEKAVALGIAV
GSGYLYETTFEKEVYSDLYGERGVLMGGIQGMFLAQYEVLRKNGHSPSEAFNETVEEATQ
SLFPLIGKYGMDYMYNACSTTARRGALDWAPKFKEANLPVFEALYNSVRDGSETRRSLEF
NSRKTYREDLQKELDEIDNQEIWRAGKTVRGLRPDVNKDEL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctccagagcttccagcaacgccctcaagcaggccctcaagtctaccgcctct
cgacaggtcgccaggaggtcctactctctcctctccggcgccgcccctagggccgccatg
gctacccgacttggcgccactcgaggcatcaagactctcgattttgccggtaccaaggag
gttgtctacgagcgtgctgactggccccttgacaagctccaagactacttcaagaatgac
actcttgccatgatcggctacggctcccagggtcacggtcagtccctcaacgcccgtgac
aacggcctcaaggttattgtcggtgtgcgaaagggtggtgagtcttggaagcaggctcag
gaggacggttgggttcccggagagactctcttcgacatccctgaggccatcaacaagggt
accatcatcatgaaccttctctccgacgctgctcagtctcagacctggaacgagattgcg
cctcttatcaccaagggcaagactctctactttgcccacggtttctctgttgtctacaag
gaggacacccacgtcattcctcccaaggatgttgatgtcatcctcgttgctcctaagggt
tctggccgaactgtccgaactcttttcctcgagggccgtggtatcaactcttccattgcc
gtttaccaggatgtgaccggtcacgccaaggagaaggctgttgcccttggtatcgccgtt
ggttccggttacctttacgagaccaccttcgagaaggaggtctactctgacctttacgga
gagcgtggtgttcttatgggcggtatccaaggtatgttcctcgcccaatacgaggttctc
aggaagaacggccactctccctctgaggccttcaacgagaccgtcgaggaggccacccag
tctcttttccctctcatcggcaagtacggtatggactacatgtacaacgcctgctccacc
accgcccgacgtggtgctcttgactgggcccccaagttcaaggaggctaaccttcccgtc
ttcgaggctctttacaactccgttagggacggttctgagacccgacgatctctcgagttc
aactccagaaagacctaccgagaggacctccagaaggagcttgacgagattgacaaccag
gaaatctggagggctggtaagaccgtccgtggtctcaggcccgacgtcaacaaggatgag
ctttaa

DBGET integrated database retrieval system