KEGG   Cryptococcus neoformans var. neoformans JEC21: CNF02480Help
Entry
CNF02480          CDS       T00243                                 

Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cne00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CNF02480
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CNF02480
Enzymes [BR:cne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     CNF02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6:join(721665..721799,721857..721945,722054..722375,722431..722676,722738..722949,722999..723173,723227..723253)
Genome map
AA seq 401 aa AA seqDB search
MSFSRASSNALKQALKSTASRQVARRSYSLLSGAAPRAAMATRLGATRGIKTLDFAGTKE
VVYERADWPLDKLQDYFKNDTLAMIGYGSQGHGQSLNARDNGLKVIVGVRKGGESWKQAQ
EDGWVPGETLFDIPEAINKGTIIMNLLSDAAQSQTWNEIAPLITKGKTLYFAHGFSVVYK
EDTHVIPPKDVDVILVAPKGSGRTVRTLFLEGRGINSSIAVYQDVTGHAKEKAVALGIAV
GSGYLYETTFEKEVYSDLYGERGVLMGGIQGMFLAQYEVLRKNGHSPSEAFNETVEEATQ
SLFPLIGKYGMDYMYNACSTTARRGALDWAPKFKEANLPVFEALYNSVRDGSETRRSLEF
NSRKTYREDLQKELDEIDNQEIWRAGKTVRGLRPDVNKDEL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctccagagcttccagcaacgccctcaagcaggccctcaagtctaccgcctct
cgacaggtcgccaggaggtcctactctctcctctccggcgccgcccctagggccgccatg
gctacccgacttggcgccactcgaggcatcaagactctcgattttgccggtaccaaggag
gttgtctacgagcgtgctgactggccccttgacaagctccaagactacttcaagaatgac
actcttgccatgatcggctacggctcccagggtcacggtcagtccctcaacgcccgtgac
aacggcctcaaggttattgtcggtgtgcgaaagggtggtgagtcttggaagcaggctcag
gaggacggttgggttcccggagagactctcttcgacatccctgaggccatcaacaagggt
accatcatcatgaaccttctctccgacgctgctcagtctcagacctggaacgagattgcg
cctcttatcaccaagggcaagactctctactttgcccacggtttctctgttgtctacaag
gaggacacccacgtcattcctcccaaggatgttgatgtcatcctcgttgctcctaagggt
tctggccgaactgtccgaactcttttcctcgagggccgtggtatcaactcttccattgcc
gtttaccaggatgtgaccggtcacgccaaggagaaggctgttgcccttggtatcgccgtt
ggttccggttacctttacgagaccaccttcgagaaggaggtctactctgacctttacgga
gagcgtggtgttcttatgggcggtatccaaggtatgttcctcgcccaatacgaggttctc
aggaagaacggccactctccctctgaggccttcaacgagaccgtcgaggaggccacccag
tctcttttccctctcatcggcaagtacggtatggactacatgtacaacgcctgctccacc
accgcccgacgtggtgctcttgactgggcccccaagttcaaggaggctaaccttcccgtc
ttcgaggctctttacaactccgttagggacggttctgagacccgacgatctctcgagttc
aactccagaaagacctaccgagaggacctccagaaggagcttgacgagattgacaaccag
gaaatctggagggctggtaagaccgtccgtggtctcaggcccgacgtcaacaaggatgag
ctttaa

DBGET integrated database retrieval system