KEGG   Cryptococcus neoformans JEC21: CNF02660Help
Entry
CNF02660          CDS       T00243                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
cne  Cryptococcus neoformans JEC21
Brite
Enzymes [BR:cne01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNF02660
Peptidases [BR:cne01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNF02660
Exosome [BR:cne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CNF02660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(759709..759779,759834..759864,759924..760073,760130..760403,760464..760652,760708..761581,761652..761986,762043..762170,762234..762572)
Genome map
AA seq 796 aa AA seqDB search
MSCTHLQPSLHSLKPPSPSQQVHREECTLCFDGQDDPRGVVVCLSCFNGACLSPDRQHAH
LHYQRTGHPLGMVIKRSRKEIRKRDSSEPPMKKLAISAPKDEEIWDYHTAFVCLACSSAG
QEITAQEPKLEEMKTGIMTALSSAQQSEIKAWEEEILPCEHTLTLQQESVVVPGNVPSQC
SSCDLTCNLWLCLTCGLANCGRQQFGGIGGNGHALKHFHETGHMLGVKLGTITPEGTADI
YCYACDDAKIDPELATHLSTFGIEVMSQTKTEKSMTELQLEHNLKFDFSMVGDDGKELEP
VFGKGLTGLRNLGNSCYMASVLQTLFSLPAFRSRYTTPEAFNHFQTCPNLLPASCIECQM
LKLGDGLLSGRYSHVARLPPPTTHFEEQEAPKFQQGIKPTQFKALIGRGHEEFSTMRQQD
SEEFLQHLLTRLRDEAKRQGRDEAAEPTEILKFAMEQRLQCGKCKRVGLQVEGVDLASLP
VEAVEAGVSEDGKKLYEGVELETCLEQLCAEEAVAEYQCDHCKEKTTAYKSTKFKTFPDL
LVLHMKKFQLVNWLPTKLDIPVSVPDMLTLDHLVAHGLQPGEEELTVSSSSPSLPEFNAT
AMAQLEAMGFPTVRCQKALLATGNSDAEIAMGWLFEHMEDPDIDAPIELGGSKAASNEPS
QEQIGMIADMGFSHNQARKALRESDGNPERAIEWLFSNPGDPGEDAAPAGSAEPSIGGSS
SLPAKYRLKAFISHKGPSVHSGHYVATIRQPQAGIEGEREEEGEWVLYNDEKVVRAASGG
GEEMRGLAYLYVYERV
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcacgcacctccagccatccctccattccctcaaaccaccctccccctcccag
caagtacaccgcgaagagtgcaccctctgcttcgacggacaggatgacccgcgaggtgtc
gtcgtatgtctttcttgcttcaatggcgcctgtctttctccagataggcagcatgcgcac
ctccattaccagagaacaggccaccctttgggtatggttatcaagcggtccaggaaagag
attcgtaaaagagactcgagtgagccgcctatgaagaaactcgccatttccgctcccaaa
gacgaggaaatatgggattaccacaccgcctttgtgtgcttggcctgctcgtctgcaggt
caagaaatcacggcgcaagaacccaagttggaggagatgaaaacggggatcatgaccgcg
ctttcctctgcccagcagtctgagatcaaggcatgggaagaagagattcttccttgtgaa
catactttgactctgcagcaagagtctgttgttgtccctggaaatgtcccatcgcaatgt
tcgtcctgcgacctgacttgcaacttgtggctatgtctcacctgcggtcttgccaattgc
ggacgacaacaattcggcggtatcgggggtaacggccatgcattgaaacattttcatgag
acggggcacatgttgggcgtcaagctgggtaccatcaccccggaaggaactgctgacatt
tactgctacgcctgtgacgatgccaagatcgaccccgaattggccactcacctttcaaca
ttcggcatcgaagtgatgagtcagaccaagactgaaaagtccatgactgaactccagctc
gaacacaacttgaaattcgatttttccatggttggcgatgacggtaaagaactcgaacct
gtctttggcaaaggtctcaccggcttgagaaacttgggaaacagctgttacatggcctct
gtcctccaaaccctcttctccctccccgctttccgatcaaggtataccacacccgaagcg
ttcaaccactttcaaacctgtcccaaccttcttcccgcttcctgtatcgaatgtcaaatg
ctcaagctcggcgatggtttgctgtccggcagatactctcatgtggcaaggctacccccg
cccaccacccatttcgaagaacaagaagctcccaaattccaacaaggaatcaagccgaca
cagtttaaagcacttatcggtagaggccacgaagagttttcgactatgcgccaacaagat
tcggaagagtttttacagcatcttttgacccggttaagagacgaagcgaagcgtcaaggt
agggacgaggccgccgagccgactgagattctcaagtttgcaatggagcagaggttgcag
tgtggcaaatgcaagcgtgtcggtctccaggtggaaggtgtagacttggcgagtttgcct
gttgaggcagtggaggcgggggtgagtgaagacggcaagaagctttacgagggggtggaa
cttgaaacgtgtttagagcaattatgtgcagaggaagcagtggccgagtaccaatgtgat
cattgcaaggagaagacgacggcgtacaaatcgaccaaattcaagacattcccagacttg
ttggtgttgcacatgaaaaagtttcaacttgtgaattggctcccaaccaagctcgatatt
cctgtatctgtccccgacatgcttactttggaccacctcgttgcccatggacttcaaccg
ggtgaagaagagctcacagtatcgtcatcgtctccttctctcccagagttcaacgccacg
gccatggcacagcttgaggctatggggttccccacagtgagatgccaaaaggcattattg
gcaactggcaacagtgacgctgagattgctatgggatggctgtttgagcatatggaagat
cccgacattgacgcgccgattgagctcgggggttcaaaagccgccagcaacgaaccttca
caagaacagattggcatgattgccgatatgggattctcacataaccaagctcgcaaagcg
ttgcgcgaaagcgacggcaaccccgagcgggccattgagtggttgtttagtaaccctggc
gatccaggagaagacgctgccccagctggtagtgccgaaccttccatcggaggttcatct
tctcttcctgccaagtaccgactgaaagcattcatttcgcacaagggcccgtctgtgcat
tctggccactatgtggctactatccggcagccgcaagcggggatcgagggagagagggaa
gaagagggagaatgggtgttgtacaatgatgaaaaggtcgtgcgagctgcgtctggcggt
ggggaggagatgagggggctcgcgtatttgtatgtatatgaacgggtgtag

DBGET integrated database retrieval system