KEGG   Cryptococcus neoformans JEC21: CNF02840Help
Entry
CNF02840          CDS       T00243                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cne  Cryptococcus neoformans JEC21
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(join(812670..812833,812891..813136,813196..813512,813570..813737,813799..813829,813886..813993,814053..814127,814203..814320,814378..814460,814609..814654,814836..814880))
Genome map
AA seq 466 aa AA seqDB search
MGSMEPILGESKRRVCYFFDSDIGNYHYGPGHPMKPTRIRMCHSLVMNYGLYKKMEIFRA
KPATKREMSQFHTDEYVDFLYRINPDNAAQFAKEQVKYNVGDDCPIFDGLFEYCSISAGG
SMEGAARLSRDKCDIAVNWAGGLHHAKKAEASGFCYVNDIVLGILELLRYHQRVLYIDID
VHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGEVRDNGIGKGKGYAINVPLRDGISDDN
YKSIFQPVIKRVIEWYQPGAVVLQCGSDSLSGDRLGSFNLSMKGHAACVQFVKSFNLPLL
LLGGGGYTVKSVSRTWAYETGLAAGMELGRDLPNNEYWEYYGPDYELDVRSSNMTDQNTP
EYLQKVTEAVFEVLRDKNAAPSVPLQSIPKMMHDDEDEDEGEDNEDRDVRRPARLWAREK
QHETSLSDSEDEGTGGRRHRRSYKESAQKNTMVEDQCNFRVNAGFT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtatggaacccattctgggggagagcaagcgaagagtttgctatttttttgac
tctgacattgggaattaccattatggacctggtcatccgatgaagcccacccgcattagg
atgtgtcactcacttgttatgaactacggcttgtacaagaagatggaaatttttcgggcc
aagcctgccactaaacgtgaaatgtctcagttccatacggatgaatacgtcgacttctta
tatcgaataaatcccgacaatgccgctcaattcgcaaaagagcaagtcaaatataacgtc
ggcgacgactgcccgatttttgatggcttgttcgaatactgctcaatctcggcagggggg
tccatggagggtgccgcgcggctttctcgcgacaaatgcgatattgctgtcaattgggcc
ggtggcttacatcacgctaaaaaggcggaagcgagtgggttctgttatgtcaatgacatt
gttctcggtatcctcgaattgttgaggtatcatcaacgtgttctgtacatcgatattgac
gtccaccacggggatggcgtggaagaagccttctacacgaccgacagggtcatgacgtgc
agttttcacaagtatggtgaatttttccctggtactggtgaagtaagagataacggaatt
ggcaaaggtaaaggatacgctatcaatgtacctcttcgagatggtatcagtgatgacaac
tataagagtattttccagcccgtaatcaaacgtgtcatcgaatggtatcaaccaggcgct
gtagtccttcaatgcggctctgattctctttccggagatcgtctgggatcgttcaatctg
tccatgaagggtcacgctgcttgtgtgcagtttgtcaaatctttcaacctgcctttattg
ttacttggcggaggtggttacacagtcaagtctgtctcaagaacttgggcatatgaaact
ggccttgctgcgggcatggagctagggcgtgatctgccgaacaacgaatattgggaatac
tatgggccagactacgagcttgatgttcgctcttccaatatgacagatcagaacactcca
gagtaccttcaaaaagtcacggaagcggtctttgaagttttacgcgataaaaatgcggcg
ccaagtgttcccctacaatctatacctaagatgatgcatgacgacgaggacgaggacgaa
ggcgaggacaatgaagatagggacgtccggcgaccagcgcggctgtgggccagggaaaag
caacatgagacatccctctccgattctgaagacgaaggcactggaggccgaagacatcgg
cgcagttacaaagagtcggcacagaagaacactatggtggaggatcaatgtaattttagg
gtaaacgcgggttttacataa

DBGET integrated database retrieval system